KEGG   Chryseobacterium gallinarum: OK18_17065Help
Entry
OK18_17065        CDS       T03954                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cgn  Chryseobacterium gallinarum
Pathway
cgn03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cgn00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    OK18_17065
Enzymes [BR:cgn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     OK18_17065
DNA repair and recombination proteins [BR:cgn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     OK18_17065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AKK74091
UniProt: A0A0G3M4L8
LinkDB All DBs
Position
3846453..3849167
Genome map
AA seq 904 aa AA seqDB search
MGLSKYRQKRSMKNTPEPFGGKSDGGELRFVIQKHDASHLHYDFRLEMDGVLKSWAVPKG
PSLDPEVKRLAMMVEDHPYDYRNFEGIIPKGQYGGGTVIVWDEGTYEPADSEKTDRKKQE
KELLHQLYSGKLRFTLHGKKLKGEFALVKAHGRGDNGWLLMKLNDEYASRKDITEKDQSV
ISGKTIAQMEEEPDKVYGKESIKKNSADKGKQNSKKEASEIINDQLEAVPTQQKEEAAHI
EPLLKKAPGQKFYTHVEPMLATLVDKPFDDEEWVYEVKWDGYRAVALMNKGKVEIKSRND
KSFNDKFYPVYDELKKFGLDAILDGEIVVLGEAGTANFGSLQNWRSEADGDLVYYVFDIL
WYKGKDLKDLSLLERKAILRAVLPESTKILPSEHFETSGITFLEEAKKLGLEGIMAKKKD
SVYHTHSRSRDWLKIKANKRQEVVIGGYTLNDDSSKLFSSILVGVYEGKKFIYTGKVGTG
FNKKTQHEMMELFKPLITKKTPFAEEPDVNKPSRFRPDPPHATVTWLRPELVCEVSFTEL
TNDGVMRHPSFDGMRDDKSAKKVVMEEETATEEAVKENDGQSIILPREKTGRKTLLNPKD
KSQVRKINRHELKFTNLDKVFWPKEGITKRDLINYYYQAAPFILPYLKERPQSMNRFPNG
IEGEGFYFKNVTDTAPDWASTYLYHSDTDNKDRHYLVGKDEATLLYMANLGCIEMNPWNS
TIKKPDYPTFCIIDLDPDKNSFDQVIEAAQVTKNILDDMGVPSYCKTSGSTGLHIYIPLA
NKYTYEQSKEFARVIVTLVHNELPKYTSIERTIKDRKGKMYLDFLQNRPHATIAAAYSVR
PKPGATVSMPLHWDEVKSGLKISDFHILNAMERMNSEGDIFKPVLGKGIDLKKVIQKFAQ
EPGE
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgggcttatctaaataccggcagaaacgctcgatgaagaatacacccgaaccttttggt
ggaaaatcagacggtggtgaactcaggtttgttatacaaaaacatgatgcttcgcatctg
cattatgatttccgccttgaaatggacggtgttttgaaaagctgggctgttccaaaagga
ccatcgctggatcctgaagtaaaacgccttgcaatgatggtagaagaccatccctatgac
taccgtaattttgaaggaatcattcccaaagggcaatatggcggtggaactgtgattgtg
tgggatgaaggaacctatgaacctgcagattccgaaaaaactgatcgtaaaaagcaggaa
aaagaacttttgcaccagctgtattccgggaagctcaggtttacacttcacggtaaaaaa
ctgaaaggggagttcgcattggtaaaagctcatggccggggcgataacggctggctcctg
atgaagcttaacgatgagtacgcaagcaggaaagatattactgaaaaagatcagtccgtt
atttcaggtaagaccattgcccaaatggaagaggagccggacaaagtgtacggtaaagaa
agcatcaaaaaaaattctgcagataaaggcaaacaaaattccaaaaaagaagcatccgaa
attattaatgaccagcttgaagcggttcccacacagcagaaagaagaagcggcacacatt
gagccattgttaaagaaagctcccgggcagaaattctatacccatgtagaacctatgctt
gccactttagttgataaaccctttgatgatgaggaatgggtatatgaggtgaaatgggac
ggataccgcgctgttgcgttaatgaacaaaggaaaggtcgaaataaaatcgcgcaatgac
aaaagcttcaatgataaattttatccggtttacgatgaactcaagaagttcggtctggat
gcaattctagatggtgaaatagtagtgctgggtgaagcgggaactgcgaacttcggctct
ctgcagaactggagatcggaagctgatggcgaccttgtttactatgtatttgatattctc
tggtataaaggtaaagatctgaaagatctttctttgctggaacgcaaagcaattctccgg
gcagtacttcccgaaagcacaaaaattcttcccagcgaacattttgaaacttccggtatc
acttttttggaagaagcaaaaaaacttgggttggaagggattatggccaagaaaaaagac
agcgtttatcatacacacagtcgttcccgtgactggctaaagatcaaagctaataaaagg
caggaagtcgtcattggaggttataccttaaatgatgattccagtaaacttttcagcagt
atcctcgtaggggtgtatgaaggaaagaaatttatttatacgggaaaagtaggtacggga
tttaataaaaagacccagcacgaaatgatggaactgtttaagccactcattactaagaaa
accccttttgcagaagaaccggatgtgaacaagccttcccgtttccgcccggatccacct
catgcaacagtcacatggttacggccggagcttgtgtgtgaggtgagttttacggaactg
acaaatgatggagttatgcgacatccatcttttgacggtatgagggatgataaaagtgca
aagaaagttgtgatggaagaagaaacagccactgaagaagcggttaaggagaatgatggg
caatctattattttgccacgtgaaaaaacaggccggaaaacacttcttaatcccaaggat
aaaagccaggtccggaagataaaccgtcatgagctgaaattcacaaatcttgataaggtt
ttctggcctaaagaagggatcactaaaagagatctgatcaattattattaccaggcagcc
ccttttattttgccctatctgaaagaacggccccaaagcatgaaccggtttcctaatggg
attgaaggggaaggcttttattttaaaaatgttaccgacacagctcccgactgggcttct
acctatctgtatcatagtgataccgacaataaagaccggcattaccttgtaggaaaggat
gaagcaactttgctgtatatggctaatctgggctgtatagaaatgaatccatggaatagt
actattaagaaaccagattatccgacattctgtattatagacctggaccccgataaaaat
tcatttgatcaggttattgaagctgctcaggtgaccaagaatatccttgatgatatgggc
gtgccgagctattgtaaaacaagcggttctacaggcctgcatatctatattcccctggct
aataaatatacttatgaacaatccaaggagtttgcaagagtaattgtaacacttgtacat
aatgagctccccaaatataccagcatcgaacggaccattaaggaccggaagggaaaaatg
tatctggattttttacagaaccggcctcatgcgactattgcagcagcctattccgtacgt
ccaaagcctggggccaccgtatcaatgccattgcattgggatgaggtaaaatctggatta
aaaatcagtgattttcatatcctgaatgctatggagcggatgaatagtgaaggagatatt
tttaaacccgttctcggtaaaggaatagatctcaaaaaagtaattcaaaaatttgctcag
gagcctggggagtaa

DBGET integrated database retrieval system