KEGG   Chryseobacterium gallinarum: OK18_18180
Entry
OK18_18180        CDS       T03954                                 

Definition
(GenBank) hypothetical protein
Organism
cgn  Chryseobacterium gallinarum
SSDB
Motif
Pfam: T6SS_TssG PAXNEB Cas_Csn2
Other DBs
NCBI-ProteinID: AKK74275
UniProt: A0A0G3M6R8
LinkDB
Position
complement(4084389..4085330)
AA seq 313 aa
MHENNIVDMNYNKLQTDFKAEAVAVNLLKYHRAVSNIFIERIGINDRAYLKDIKSISSSY
LGFDEEVFTIECYREGIYDYLPEGLFHPPSLGASRKNVDTIVREIRKQKRVEEDARRFFR
PFELEVFFTEISALLKESEFDITSNTDSLLETVSELWPLIKMLDKQNAYIFMHILPFFHQ
IRGSKRWFERCMTAFLQVPVEVSFSPNVIDRIEENDDSMLLGNSRLGVTYIPSGKHMDGQ
RNWVVNIGPIPYEEMKKYIPGSPFRKVLQALYDYFLPVTVDVEENFVTEKQGYSFSLEDD
ERNASRLGYSTFL
NT seq 942 nt   +upstreamnt  +downstreamnt
atgcatgagaataatattgtagatatgaattacaataagctgcagacagactttaaagcg
gaggctgtagcagtgaaccttttgaaatatcatagggcggtaagtaatatatttattgaa
cggatcgggatcaatgaccgtgcttaccttaaagacattaaaagcatttcgagcagttat
ttaggatttgatgaagaggtttttacaatagaatgttacagggaaggaatttacgattat
cttccggaaggattgtttcatccaccatccctgggcgcctccagaaaaaatgtcgatact
attgtaagggaaatccggaaacaaaaaagagtagaggaggatgcccgcaggtttttccgg
ccttttgagctggaggtatttttcactgagatcagcgccctgcttaaagagtcggaattt
gatattacaagtaatacggattccttgctggaaacggtaagtgaactttggcccctgatt
aagatgctggacaagcaaaatgcctatatttttatgcatattctacctttttttcatcag
atcagaggaagtaaaaggtggtttgaaagatgtatgactgcttttctccaggtcccggtg
gaagtgagcttttctcctaatgttattgaccggatagaggagaatgatgattccatgctt
ctgggaaattcaagattaggggtaacgtatatcccaagcggaaaacatatggacggacaa
aggaattgggtggtgaatattggtccgattccctatgaagaaatgaaaaaatatattccc
ggaagtccgttcaggaaagtactacaggcactgtatgattattttcttcctgtcactgta
gatgtagaggagaattttgtgacagaaaaacagggatactcattcagtcttgaggatgat
gaaagaaatgccagccgccttggttactctactttcctctag

DBGET integrated database retrieval system