KEGG   Chryseobacterium gallinarum: OK18_18800Help
Entry
OK18_18800        CDS       T03954                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cgn  Chryseobacterium gallinarum
Pathway
cgn00020  Citrate cycle (TCA cycle)
cgn00310  Lysine degradation
cgn00380  Tryptophan metabolism
cgn01100  Metabolic pathways
cgn01110  Biosynthesis of secondary metabolites
cgn01120  Microbial metabolism in diverse environments
cgn01130  Biosynthesis of antibiotics
cgn01200  Carbon metabolism
Module
cgn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cgn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OK18_18800
  09105 Amino acid metabolism
   00310 Lysine degradation
    OK18_18800
   00380 Tryptophan metabolism
    OK18_18800
Enzymes [BR:cgn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     OK18_18800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N AHSP
Motif
Other DBs
NCBI-ProteinID: AKK74386
UniProt: A0A0G3M5D1
LinkDB All DBs
Position
complement(4221361..4224174)
Genome map
AA seq 937 aa AA seqDB search
MDRFSFLNAAHSQLIEDLYQQYLKFPDSLEPSWKAFFQGFDFALENYGDDDNIQFTQASA
STAPAVQQISQAVSNGEVPEHIKKEFKVVNLIEAYRTRGHLFTKTNPVRERRHYTPTLDI
ENFGLSKEDLNTKFNCAVETGMKEPATLAELIKHLENIYCDSIGVEYMHINNVEEKDFIK
KWLQVNENHPSLSANEKTEILLKLNQAVAFENYLHTKFVGQKRFSLEGGETLIPALDQLI
SRSSQLGVDEVVLGMAHRGRLNVLTNIFGKSYKQIFSEFEGKEFEEDVFSGDVKYHLGSS
KKIKTASGEEVCINLTPNPSHLETVAALVEGICRAKVDDKYKDFSKVLPIIIHGDGAIAG
QGIAYEVAQMMTLEGYRTGGTVHIVVNNQVSFTTNYMDARSSTYCTDIAKVTESPVMHVN
ADDAEAVVHAIHFAADFRAKFGKDVYIDLLGYRKYGHNEGDEPRFTQPNLYKIISKHPNP
REIYKDKLLKDSVTSNDVIAKMETEFKALLDKDFDASKEIEKNVMDVFMAEDWVNYPIGK
RGALQLPVDTKYDLAKLKELAIKMSTLPADKKFINKITRLFDNRIKAIEGNSLDWALGEW
LAYATLLVEGHNVRISGEDVERGTFSHRHAVVKTEDTEEEYIPLRHVSESRFDVYNSHLS
EYGVLGFDYGYAMASPNTLTIWEAQFGDFVNGAQIIVDQYLAAAEEKWKIQDGLVMLLPH
GSEGQGAEHSSARLERFLTLCANENMVVANVTSPANYFHLLRRQLKWAFRKPLVVMSPKS
LLRHPKVVSPLEDFANGSFQPILDDPTADPKKVEKLVLCSGKLYFELLAKKEELNCENIA
LVRFEQLYPLQTDAIEAIFNKYENRKQLVWAQEEPENMGAWSYILRNFRDTGIQVVAPVP
SGAPAPGSHKMFEKNQNAVINRVFDRDDAPAKRPVTA
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atggacagattttcattcctaaacgcagctcattctcaattaattgaggatttataccaa
cagtacttaaaattcccggattccctagaaccatcatggaaagctttctttcaaggcttc
gattttgctttagagaactacggagatgacgataacatccaatttactcaggcttcggcc
agcactgctccggcagtacagcaaatttctcaggccgtatcaaatggagaggttcctgag
cacattaaaaaagaattcaaagttgtaaaccttattgaggcttacagaacaagagggcat
ctgtttacaaaaacaaaccctgtcagagaaagaagacattatacccctactttagatatc
gaaaacttcggtctttctaaagaagatttaaatacaaaattcaactgtgccgttgaaaca
ggaatgaaagagcctgctacattagcagaattgatcaagcaccttgaaaatatctactgt
gattctatcggggtggaatatatgcacatcaacaatgttgaagaaaaagattttatcaag
aaatggctgcaggtaaatgaaaaccatccgagtctttctgcgaatgaaaaaacagaaatc
ttattaaaattaaatcaggcagttgcgtttgaaaactatcttcatacgaaatttgtaggt
cagaagagattctctctggaaggaggagaaacattgattcctgctttagaccagctgatc
tcaagatcttctcaattgggagtggatgaagtggtattaggaatggctcacagagggaga
ttaaatgtattgaccaatattttcggaaaatcctataagcagatcttttcagaatttgaa
ggaaaagaattcgaagaagatgtattctcaggggatgttaaataccatttgggatcatcc
aaaaagatcaaaacggcttcaggagaagaagtttgcattaacctgactccgaacccatct
caccttgaaacggttgctgctcttgtagaagggatctgccgtgcaaaggtagacgataag
tacaaggatttctctaaagttttacctatcatcattcatggtgatggagctattgctgga
caaggtatagcttatgaagttgcccagatgatgacattggaaggctacagaacaggtgga
acagttcatatcgttgtaaacaaccaggtatcgtttacaacaaattatatggatgcaaga
tcttcaacctactgtacagacatcgcaaaagttacggaatctcctgtaatgcatgtcaat
gcagatgatgctgaagctgttgttcatgctattcactttgctgctgatttcagggctaaa
tttggtaaagatgtttatatcgaccttttaggatatagaaaatacggtcacaacgaaggt
gacgaaccaaggttcacccaacctaatttgtataaaataatttcaaaacacccgaatcca
agagaaatttataaagataaattactgaaagacagcgttacttcaaacgatgtaatcgct
aaaatggagacggaattcaaagcccttctggataaggattttgatgcttccaaggaaatt
gagaaaaatgtaatggatgtgttcatggccgaagattgggtaaattatccgatcggaaaa
agaggagcacttcagttaccggttgatacaaaatatgacctggccaaattgaaagaactg
gctattaaaatgtcaacccttcctgcagataagaaattcatcaataagattacaagactt
tttgataaccgtattaaagcgatcgaaggaaactcattagactgggcgttaggagagtgg
ctggcatatgcaacccttcttgtagaaggtcataatgtgagaatctccggagaagacgtg
gaaagaggaactttctctcacaggcatgctgtagtaaaaacagaagatacagaagaagaa
tacatcccgttaagacacgtatctgaaagcagatttgatgtttacaattcccatctttcg
gaatatggggttttaggcttcgattacggatatgcaatggcttcaccaaatacattaacg
atctgggaggctcagttcggagatttcgtgaacggtgcccagattatcgtagaccaatat
ctggcggcagcagaagaaaagtggaaaatccaggatggtttagtaatgctattgcctcac
ggatcagaaggccagggtgcagaacactcttcagcaagactggaaagattcttaacactt
tgtgctaatgaaaatatggtagtagctaacgttacttcaccagccaactatttccacctg
ttgagaagacaactgaaatgggcattcagaaaaccattggtggtaatgagtcctaaatcc
ctgttgagacatccaaaagtagtttctccgcttgaagactttgcaaacggttcattccag
ccaattctggatgatcctacagcagatcctaaaaaagttgaaaaattagttctttgctca
ggtaaattatactttgaactattggcgaaaaaagaagaattaaactgtgaaaatattgca
ttggtaagatttgagcagctgtatcctcttcaaacggatgctattgaagctattttcaac
aaatatgagaacaggaaacagttggtttgggcacaggaagaacctgagaatatgggagcc
tggtcttatatcctgagaaacttcagagacaccggaatccaggtagtggctccggtacca
agtggtgcaccggctccgggtagccacaaaatgttcgagaaaaaccagaacgcagtaatc
aacagggttttcgacagagacgatgctccggcaaaaagacctgttaccgcttaa

DBGET integrated database retrieval system