KEGG   Coriobacterium glomerans: Corgl_0200Help
Entry
Corgl_0200        CDS       T01453                                 

Definition
(GenBank) phage SPO1 DNA polymerase-related protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
cgo  Coriobacterium glomerans
Pathway
cgo03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cgo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Corgl_0200
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cgo03400]
    Corgl_0200
Enzymes [BR:cgo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     Corgl_0200
DNA repair and recombination proteins [BR:cgo03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Corgl_0200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AEB06327
UniProt: F2NAE1
LinkDB All DBs
Position
234339..235007
Genome map
AA seq 222 aa AA seqDB search
MSVMRIPGHENQGPREVELREVRAVLGECRRCQLAQTRTKIVFGTGDENARVLFIGEAPG
KNEDLQGEPFVGAAGKNLDGILSLAGLRREEVYIANVLKCRPPGNRDPRPEEVLACAPFL
REQIRSIWPDVIVTMGNPATHFILKTEIGITRLRGRFHQMGRFAVMPTFHPAAALRNPAW
QDLIEADFNMLGDYLRRHAAPTALDDTASSASPKGETHVDRT
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcatgcgcattcccggtcatgagaatcagggccctcgtgaagtcgagcttcgg
gaggtgcgggcggtactcggtgagtgccggcgctgccagcttgctcagactcgcacgaag
atcgtgttcggaaccggtgatgagaacgctcgcgtcctgttcatcggcgaggcgcccggc
aagaacgaggatctgcagggagagcccttcgtaggtgccgccggaaagaacctggatggc
atcctgtcgctcgccggcctcaggcgcgaggaggtctacatcgccaacgtgctgaaatgt
cgacctcctggaaaccgtgatccgcgtcccgaggaggtgctggcctgcgccccgtttctc
agggagcagattcgcagcatctggcccgatgtcatcgtgacgatgggcaaccccgcaacg
catttcattctgaagacggagatcgggatcacgagacttcgcggtcggtttcatcaaatg
ggccgtttcgctgtcatgcccacattccatccggctgccgcgctgcgcaatcccgcttgg
caggatctgatcgaggctgatttcaacatgctcggtgactatctgagaaggcacgcagct
ccaacggctctcgacgacacggcgtcaagtgcgagtccaaagggggagacgcatgtcgat
cgcacgtga

DBGET integrated database retrieval system