KEGG   Coriobacterium glomerans: Corgl_1202Help
Entry
Corgl_1202        CDS       T01453                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IA, variant 3
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
cgo  Coriobacterium glomerans
Pathway
cgo00630  Glyoxylate and dicarboxylate metabolism
cgo01100  Metabolic pathways
cgo01110  Biosynthesis of secondary metabolites
cgo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Corgl_1202
Enzymes [BR:cgo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     Corgl_1202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Acid_PPase Ub-Mut7C
Motif
Other DBs
NCBI-ProteinID: AEB07305
UniProt: F2N8C2
LinkDB All DBs
Position
complement(1407416..1408099)
Genome map
AA seq 227 aa AA seqDB search
MEDVDATDLFLRPVVVFDFDGTLADTADSIKRTARHVLEEMGMPADEIDEARLNSMIGPP
LEEGFHDLFGLTSAGSQRACARYRELYAQLDPSACPPMPHAIELVDMLGRQGRTLAVATS
RREDVAERLLVQIGLRDSFAAVAGHLEPYRRTKAASIAAALEMCGARPADAVMVGDRFHD
IEGAHELDVPAIGVYTGTAEPGELERSGADAILWGLEEAIIKMRRSS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgtggatgcgacggatctgttcttgcggccggtcgttgtcttcgatttcgac
ggcacgctcgccgacacggccgactccatcaagcgcacagcgcgccacgtgctcgaagag
atggggatgcccgccgacgagatcgatgaggcgcggctcaacagcatgatcggtccgccg
ctcgaggaggggttccacgatctgttcggcctgacgagcgcgggctcccagcgggcctgt
gcgcgctatcgcgagctgtacgcccagttggatccgagcgcatgcccgccgatgccgcac
gcgatcgagcttgtggatatgctcgggcggcaggggcgcacgctggccgtcgccacgtcc
agacgcgaggacgtcgccgagcggctgctcgttcagatcggtctgcgcgacagcttcgca
gccgtcgcggggcacctggagccctatcggcgcacgaaggcggcatcgatcgccgccgcc
ctcgagatgtgcggcgcgcgcccggcagacgccgtcatggtaggcgatcgcttccatgat
atcgagggcgcccacgagctggacgtccccgcgatcggtgtgtacaccggcactgcggag
cccggagaactcgagcgctcgggtgccgatgcgattctttggggactcgaggaggcaatc
atcaagatgaggaggagctcatga

DBGET integrated database retrieval system