KEGG   Coriobacterium glomerans: Corgl_1468Help
Entry
Corgl_1468        CDS       T01453                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cgo  Coriobacterium glomerans
Pathway
cgo00620  Pyruvate metabolism
cgo00680  Methane metabolism
cgo01100  Metabolic pathways
cgo01120  Microbial metabolism in diverse environments
cgo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Corgl_1468
  09102 Energy metabolism
   00680 Methane metabolism
    Corgl_1468
Enzymes [BR:cgo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Corgl_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 TPR_14 Osmo_CC
Motif
Other DBs
NCBI-ProteinID: AEB07568
UniProt: F2N8W8
LinkDB All DBs
Position
complement(1711788..1714664)
Genome map
AA seq 958 aa AA seqDB search
MIRPRCEAKPAAAIDSKQTETVYRLANEAIFAGRIDAVETKAAADTLADIDVPTLLRDNL
ELFLRLERKILQEYDPAVRRLFDELLDDVINVTAPETSSVPSQVPSGCSEAGSGDEPATR
GTARVSDNDGSEVFRDAVALLDSVPAERQQILVRAFTSFFHLANLTEENFRVRSLKKRES
EVSIDSAVDPSNELTVAYRRLIEETGVQRATQLLDRLEFHPVFTAHPTDARRKAVEGKIR
RIAALLDQRPRLGGSDLVENERHMLQEIDALLRTSPTAIKKPTPVEEVDTIIDIFDGTLF
DTIPQVYRRFDDWVLGERAGRVPPVCPAFFHPGSWIAADRDGNPNVNARVSRLAAMKLSA
HMVSSLARKCRSVGRNLTLDSACAEPSEELRGLWRRQVEMSSTLTDRAQAISQSEPHRAV
MLVMCARLEATVARNADNMYRDCAEFLDDLRIVQRSLAAAGAPRAAFGPLQTLIWQTETF
GFHMVEMEFRQHSVVHTRALEDIRAHGLTGDLEPMTREVLDTFRALGFIQRRLGARAARR
YVVSFTKSAQHIADVFELARLSFADPKDVPTIDVIPLFEQLEDLEGCIDILDQMLEDPDV
SRRLSESSRRMEIMLGYSDSSKDAGPTTATLALHDAQRRIALWAQRNDIDLTLFHGRGGA
VGRGGGPANRAVLAQPRGSVNCRFKVTEQGEVIFARYGNPSLARRHIESVAAATLLNSAP
SVERENTEMTASFSQVAVRLSDFSHERYRALLESDDFASWFSTVTPLAEVGLLPIGSRPA
KRGLGAQSLDDLRTIPWVFSWSQARINLAAWYGLGTACERLGDLDLLRRAYREWPLFATF
IDNIEMSIAKTDERIAKMYLALGKREDLARQVLEEMRLTRAWTLAITGNSWPLQHRRVLG
YAVRVRNPYVNALSLAQARALRNVRAPIGDISEQDKKEYLDLILSTVAGVSAGLQNTG
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgaccacgttgtgaagccaagcccgcagcggcaatcgactcgaagcagacggag
acggtctacaggctggcgaacgaggcgatcttcgccggacgcatcgatgccgtcgaaacg
aaggcagccgcagacacgctggcggacatcgatgttccgacactgctgcgcgacaatctc
gagctgttcttgcgcttggagcgcaagatccttcaagagtacgatcccgcggttcgcagg
ctcttcgatgagctgctcgatgatgtgatcaacgtgaccgcgcccgaaacatcttcggtg
ccttcgcaggttccaagcgggtgttccgaagccggatccggcgatgagcccgcgacccgg
gggacggcccgcgtctcggacaacgacggttccgaggtgtttcgcgacgccgtggcgctg
ctcgactcggtgcccgcggagcgccagcagatcctcgtccgcgcgttcacatccttcttc
catttggcgaatctcaccgaggagaacttccgggttcgctcgctcaagaagcgggagagc
gaagtttcgatcgactctgcggtcgatccgtccaacgagctgaccgtcgcctatcgccgg
ctcatcgaagagaccggggtgcagcgcgcgacacagctgctcgatcgactcgagtttcac
cctgtcttcaccgcgcatcccaccgatgcgcggcgcaaggctgtcgagggaaagatccgc
aggatcgctgctctgcttgaccagaggccgcgtctcggaggatccgatctcgtggagaac
gagcgccatatgcttcaagagatcgatgcgcttctgcgcacctctcccacagcgatcaag
aagccgacgccggtcgaggaggtcgatacgatcatcgacatcttcgatgggacgctgttc
gatacgatcccccaggtgtatcgccggttcgacgactgggtgctcggcgagcgcgcaggc
cgcgtgccaccggtgtgccccgcgttctttcatcccggaagctggatcgcagcggaccgc
gatggcaacccgaacgtgaacgccagagtgagccgtctggcggcgatgaagctgtcggct
cacatggtgtcgtctctcgcgcgcaagtgccgcagcgtgggccgcaatctcacgctcgat
tcggcgtgcgccgaaccatccgaggagctgcgcggactgtggagacgacaggttgagatg
agctccaccttgacggatcgcgctcaggccatctcgcaatccgagcctcaccgtgcagtg
atgctcgtgatgtgcgcacgtttggaggccaccgtcgctcgcaacgcggacaacatgtat
cgcgactgcgccgagttcttggatgacctgcgcatcgtgcagcgctcacttgccgcggcg
ggagccccgcgcgcggccttcggacctctccagacgcttatctggcagacggagacgttc
ggcttccacatggtcgagatggagtttcgccagcactccgtcgtgcacacccgtgctctg
gaggatatccgagctcatggtctgaccggtgatctcgagcccatgacgcgcgaggtgctg
gacaccttcagagctcttggatttatccagcgtcgtctgggcgcgcgcgccgcgaggcgc
tacgtcgtctcgttcacgaaatcggctcagcacatcgccgatgtcttcgagctcgcgcgt
ctttcattcgccgatccgaaagatgtgccgacgatcgacgtgattccgctcttcgaacag
cttgaggaccttgagggatgcatcgatatcctcgatcagatgcttgaggatccagatgtc
tcgcgtcggctttccgaatcgagccgcaggatggagatcatgctcggctactccgattcg
tcgaaggacgccggaccgaccacggcgacgctcgcgttacatgacgcgcagcgcaggatc
gctctctgggcgcagcgcaatgacatcgatctcacgctcttccatgggcgcggcggagca
gtcggtcgcggtgggggtccggcgaacagggcggtgctcgcgcaaccgagaggatctgtc
aattgccgtttcaaggtcaccgagcagggggaggtcatctttgcccgttacggcaatccg
tctctggcgcgccgtcacatcgagagcgttgccgcagcgaccctgctgaactccgctcca
tcggtcgagcgcgagaacaccgagatgaccgcgagcttctcgcaagttgcagtcaggttg
agcgatttttcgcatgagcgctaccgcgcactgctcgaatcggatgatttcgcgtcttgg
ttctcgacggtgacacctctcgccgaggtggggcttcttcctatcggtagccgtcccgcc
aagcgaggactcggtgcgcagtcgctggacgatctcagaaccatcccttgggttttctca
tggtctcaggcgcgtatcaatcttgcagcctggtacggtctcggaaccgcttgcgagcgg
ctcggagatcttgatctgctcaggcgagcctatcgtgaatggcccctgttcgccacattt
atcgacaacatcgagatgtcgatcgcgaaaacagacgagagaatcgcgaagatgtatctc
gctttggggaagcgcgaggatctggctcgccaggtgctcgaggagatgcgtctcacccgt
gcctggacgctggctataacaggcaactcgtggccgctgcagcatcgccgcgtgctcggg
tacgccgtgcgcgtacgaaacccgtatgtgaacgcgctttcgctcgctcaggcgcgcgcg
cttcgcaacgtcagagcgccgatcggcgatatttccgaacaggacaagaaagagtatctg
gatctgatcctgtccacggtggcaggcgtgagcgccggcttgcagaacaccgggtag

DBGET integrated database retrieval system