KEGG   Corynebacterium glutamicum AR1: CGLAR1_03405Help
Entry
CGLAR1_03405      CDS       T03362                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cgq  Corynebacterium glutamicum AR1
Pathway
cgq00473  D-Alanine metabolism
cgq01100  Metabolic pathways
cgq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cgq00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CGLAR1_03405
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CGLAR1_03405
Enzymes [BR:cgq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CGLAR1_03405
Peptidoglycan biosynthesis and degradation proteins [BR:cgq01011]
 Precursor biosynthesis
  Racemase
   CGLAR1_03405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIK84324
LinkDB All DBs
Structure
PDB: 

Position
670181..671266
Genome map
AA seq 361 aa AA seqDB search
MNLLTTKIDLDAIAHNTRVLKQMAGPAKLMAVVKANAYNHGVEKVAPVIAAHGADAFGVA
TLAEAMQLRDIGISQEVLCWIWTPEQDFRAAIDRNIDLAVISPAHAKALIDTDAEHIRVS
IKIDSGLHRSGVDEQEWEGVFSALAAAPHIEVTGMFTHLACADEPENPETDRQIIAFRRA
LALARKHGLECPVNHVCNSPAFLTRSDLHMEMVRPGLAFYGLEPVAGLEHGLKPAMTWEA
KVSVVKQIEAGQGTSYGLTWRAEDRGFVAVVPAGYADGMPRHAQGKFSVTIDGVDYPQIG
RVCMDQFVISLGDNPHGVEAGAKAVIFGENGHDATDFAERLDTINYEVVCRPTGRTVRAY
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgctgaccaccaaaattgacctggatgccatcgcccataacacgagggtgctt
aaacaaatggcgggtccggcgaagctgatggcggtggtgaaggcgaatgcatataaccat
ggcgtggagaaggtcgctccggttattgctgctcatggtgcggatgcgtttggtgtggca
actcttgcggaggctatgcagttgcgtgatatcggcatcagccaagaggttttgtgttgg
atttggacaccggaacaggatttccgcgccgccattgatcgcaatattgatttggctgtt
atttctcccgcgcatgccaaagccttgatcgacactgatgcggagcatattcgggtgtcc
atcaagattgattcggggttgcatcgttcgggtgtggatgagcaggagtgggagggcgtg
ttcagcgcgttggctgctgccccgcacattgaggtcacgggcatgttcacgcacttggcg
tgcgcggatgagccagagaatccggaaactgatcgccaaattattgcttttcgacgcgcc
cttgcgctcgcccgcaagcacgggcttgagtgcccggtcaaccacgtatgcaactcacct
gcatttttgactcgatctgacttacacatggagatggtccgaccgggtttggccttttat
gggttggaacccgtggcgggactggagcatggtttgaagccggctatgacgtgggaggcg
aaggtgagcgtcgtaaagcaaattgaagctggacaaggcacctcttatggcctgacctgg
cgcgctgaggatcgcggctttgtggctgtggtgcctgcgggctatgcagatggcatgccg
cgacatgcccaggggaaattctccgtcacgattgatggcgtggactatccgcagattggg
cgcgtatgcatggatcagttcgttatttctttgggcgacaatccacacggcgtggaagct
ggcgcgaaggccgtgatattcggtgagaatgggcatgacgcaactgattttgcggagcgt
ttagacaccattaactatgaggtagtgtgccgaccaaccggccgaactgtccgcgcatat
gtttaa

DBGET integrated database retrieval system