KEGG   Corynebacterium glutamicum AR1: CGLAR1_06980Help
Entry
CGLAR1_06980      CDS       T03362                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cgq  Corynebacterium glutamicum AR1
Pathway
cgq00473  D-Alanine metabolism
cgq00550  Peptidoglycan biosynthesis
cgq01100  Metabolic pathways
cgq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cgq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CGLAR1_06980
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CGLAR1_06980
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CGLAR1_06980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cgq01011]
    CGLAR1_06980
Enzymes [BR:cgq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CGLAR1_06980
Peptidoglycan biosynthesis and degradation proteins [BR:cgq01011]
 Precursor biosynthesis
  Amino acid ligase
   CGLAR1_06980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATPgrasp_ST CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AIK84999
UniProt: A0A1Q6BQ17
LinkDB All DBs
Position
1444332..1445414
Genome map
AA seq 360 aa AA seqDB search
MSNSNSGKVRVAVVYGGRSSEHSVSCVSAGAIMAHLDPEKYDVIPVGITVDGAWVVGETD
PQKLTLIDRTMPEVEHREEVRPSLDPAHRGEFHFSDGSLYATADVIFPVLHGRFGEDGTV
QGLFALSDIPVVGPGVLASAAGMDKEYTKKLMAAEGLPVGREVILRDRTELTEAEKNLLG
LPVFVKPARGGSSIGISRVTAWEDFNKAVGLARAHDEKVIVESEIVGSEVECGVLQYPDG
RIVASVPALLSGTESGAGGFYDFDTKYLDNVVTAEIPAPLDEKTTELIQSLAVESFQALA
CEGLARVDFFVTANGPVLNEINTMPGFTPISMYPQMFTASGVAYEELLDVLVQQALHRDN
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaactctaattctggaaaagtccgcgtcgcagtcgtttatggtggtcgcagttct
gagcactccgtctcctgcgtctccgctggtgctatcatggcccatctcgatcctgagaag
tacgatgtgattcccgtcggcattactgtcgacggcgcgtgggttgttggtgaaaccgat
ccacagaagctaactctcatcgatcgcaccatgcctgaggtggagcatcgtgaagaggtt
cgcccaagcctggatcccgcacaccgtggagagttccacttttccgatggcagcttgtat
gccaccgctgatgtgattttccctgtgctgcatggtcgttttggtgaagacggcactgtg
cagggtctatttgcactgtctgatattccggtcgttggcccaggtgtgctggcctctgct
gcgggaatggacaaggaatacactaagaagctcatggcagcggaaggcctgcccgttggc
cgtgaggtgattctacgtgatcgtaccgagctgaccgaggcagaaaagaacctgctgggc
ctgcctgtatttgtgaagcctgcgcgtggtggctcatcgattggtatctctcgtgttact
gcgtgggaggattttaataaggctgtggggcttgctcgtgcccatgatgagaaggtcatt
gtggaatcagagatcgttggctctgaggtggagtgcggcgtgttgcagtacccagacggt
cgtatcgtggcatctgttcctgccttgctgtctggcaccgaatcaggcgctggcggattc
tatgactttgataccaagtacttggacaacgttgttactgcagagatcccagcaccgctt
gatgagaagaccacggaactgatccagtctttggctgtggaatctttccaggctcttgcg
tgtgaaggccttgcccgcgtggacttctttgttaccgccaatggtcctgtgctcaatgag
atcaacaccatgccaggatttacccccatttccatgtacccacagatgttcactgcatca
ggcgtggcctatgaggaattgttggatgtgttggtgcagcaggcattgcaccgcgataat
taa

DBGET integrated database retrieval system