KEGG   Corynebacterium glutamicum AR1: CGLAR1_09260Help
Entry
CGLAR1_09260      CDS       T03362                                 

Definition
(GenBank) prolyl-tRNA synthetase
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
cgq  Corynebacterium glutamicum AR1
Pathway
cgq00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cgq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CGLAR1_09260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cgq01007]
    CGLAR1_09260
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cgq03016]
    CGLAR1_09260
Enzymes [BR:cgq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     CGLAR1_09260
Amino acid related enzymes [BR:cgq01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   CGLAR1_09260
Transfer RNA biogenesis [BR:cgq03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CGLAR1_09260
 Prokaryotic type
    CGLAR1_09260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b tRNA_edit HGTP_anticodon
Motif
Other DBs
NCBI-ProteinID: AIK85430
LinkDB All DBs
Position
complement(1941034..1942800)
Genome map
AA seq 588 aa AA seqDB search
MITRLSTLFLRTLREDPADAEVPSHKLLVRAGYIRRVAPGIYSWLPLGLRAVRNIEAVVR
EEMDAIGGQELLFPALLPREPYETTQRWTEYGDSLFRLKDRKGADYLLGPTHEEMFAATV
KDLYNSYKDFPVTLYQIQTKYRDEERPRAGVLRGREFVMKDSYSFDISDAGLDESYAKHR
AAYQRIFDRLGLEYAICQATSGAMGGSASEEFLAVSENGEDTFVRSTSGNYAANVEAVVT
QPGVERDIEGLPEAVTYETPVSETIDALVDWANSIDVQIEGREVTAADTLKCIVVKVREP
GAEEAELTGILLPGDREVDMKRLEASLEPAEVELAVESDFADNPFLVKGYVGPVGLAKNG
VKVLADPRVVTGTSWITGADEKERHVVGLVAGRDFTPDGFIEAAEIKEGDPAPAGEGTLT
LARGIEIGHIFQLGRKYTEAFDVQILDENGKRAIPTMGSYGLGVTRLLAVLAEQRHDDAG
LNWSVEVAPYQVHVVAANKDAAAIEAAERFAAELSAAGLDVLFDDRPKVSPGVKFKDAEL
LGMPFALILGRGYAEGKVELRVRGGEKSELDADQAVAQIVEMVAQARN
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgatcacacgtctttccacgctgtttttgcgcaccctgcgcgaagaccctgcagatgca
gaagttccaagccacaagctgcttgtccgtgcaggatatatccgccgagttgccccaggt
atctactcctggttgccactgggtttgcgcgcagtgcgcaacattgaagctgtcgtacgc
gaggaaatggacgcgatcggaggacaggagctgctcttcccagcactcctgccacgtgag
ccttatgaaaccacacagcgttggacagaatacggcgattcgctgttccgtctgaaggac
cgcaagggtgccgactacctgctcggaccaacccacgaggaaatgttcgccgccacggtg
aaggatctgtacaactcctacaaggacttcccagtcaccttgtaccagatccagaccaag
taccgcgatgaggaacgcccacgcgcaggcgtgctccgcggacgcgaatttgtgatgaag
gattcttactccttcgacatctcggatgctggtttggacgagtcctacgcaaagcaccgc
gcagcgtatcagcgcatctttgaccgccttggcttggaatacgccatctgccaggcaacc
tctggtgccatgggcggatccgcttccgaggaattccttgcagtatctgaaaacggcgaa
gataccttcgtgcgctctacctccggcaattacgccgcaaacgtggaagctgttgttacc
cagccaggcgttgagcgtgacatcgaaggcctgccagaagcagtcacctacgaaactcct
gtttctgaaaccatcgatgctttggttgattgggctaactccatcgacgtgcagatcgag
ggccgcgaggtcaccgcagctgacaccctcaagtgcatcgtggtgaaggtccgcgagcca
ggtgccgaagaagcagaactcactggaatcttgcttccaggtgaccgcgaagtagacatg
aagcgcctcgaggcatcacttgagccagcagaagttgaactcgcagtggaatccgacttt
gccgacaacccattcctggtcaagggctacgtcggaccagttggcctggccaagaacggc
gtgaaggtccttgccgatcctcgcgttgtcaccggtacctcctggatcaccggcgccgat
gaaaaggaacgccacgtcgtaggcctcgtcgccggacgcgatttcaccccagacggcttc
atcgaagctgcagaaatcaaggaaggcgacccagcgccagcaggcgagggcaccctcacc
cttgctcgcggcatcgaaattggccatatcttccagctcggccgcaagtacaccgaagcc
ttcgacgtccaaatcctggacgaaaacggcaagcgcgccatcccaaccatgggctcctac
ggcctcggtgtcacccgcctgctcgccgtcctggcagaacagcgccacgatgacgctggc
ctcaactggtccgtcgaagtcgctccgtaccaggtccatgtcgtcgcagctaacaaagac
gccgcagccatcgaggcagcagagcgctttgcggctgagctgtctgccgcaggcttggac
gtgcttttcgacgaccgacccaaggttagccctggcgtaaagttcaaagacgccgaactt
cttggcatgccattcgccttgattcttggccgtggctacgccgaaggcaaggttgaactc
cgtgtccgcggtggcgagaagtccgaactcgacgcagatcaggctgtcgcccagatcgtc
gagatggttgctcaagcccgcaactag

DBGET integrated database retrieval system