KEGG   Corynebacterium glutamicum AR1: CGLAR1_10185Help
Entry
CGLAR1_10185      CDS       T03362                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cgq  Corynebacterium glutamicum AR1
Brite
KEGG Orthology (KO) [BR:cgq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cgq01001]
    CGLAR1_10185
Enzymes [BR:cgq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CGLAR1_10185
Protein kinases [BR:cgq01001]
 Serine/threonine kinases: Other
  Bacterial family
   CGLAR1_10185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Pkinase_fungal Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-ProteinID: AIK85606
LinkDB All DBs
Position
2139358..2141592
Genome map
AA seq 744 aa AA seqDB search
MANLKVGDVLEDRYRIETPIARGGMSTVYRCLDLRLGRSMALKVMEEDFVDDPIFRQRFR
REARSMAQLNHPNLVNVYDFSATDGLVYLVMELITGGTLRELLAERGPMPPHAAVGVMRG
VLTGLAAAHRAGMVHRDIKPDNVLINSDHQVKLSDFGLVRAAHAGQSQDNQIVGTVAYLS
PEQVEGGEIGPASDVYSAGIVLFELLTGTTPFSGEDDLDHAYARLTEVVPAPSSLIDGVP
SLIDELVATATSINPEDRFDDSGEFLSALEDVATELSLPAFRVPVPVNSAANRANAQVPD
AQPTDMFTTHIPKTPEPDHTAIIPVASANETSILPAQNMGQNMAQNMAQNPLQPPEPDFA
PEPPPDTALNIQDQELARADEPEINTVSNRSKLKLTLWSIFVVAVIAAVAVGGWWFGSGR
YGEIPQVLGMDEVQAVAVVEEAGFVAVAEPQYDNEVPTGSIIGTEPSFGERLPRGEDVSV
LVSQGRPVVPDLSEDRSLSTVREELEQRTFVWVDGPGEYSDDVPEGQVVSFTPSSGTQLD
VGETVQIHLSRGPAPVEIPDVSGMGVDQATRVLERAGLSVERTEEGFDAETPNGDVYGTS
PQVSTEVKRGTSVVLQISNAISVPDVVGMTKDEATAALAEEGLVVASTSIIPGEAASSAD
TVVTVEPESGSRVDPAHPQVSLGLAGEIQVPSVVGRKVSDARSILEEAGLTLTTDADDND
RIYSQTPRARSEVSVGGEVTVRAF
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacttgaaggtcggtgacgttttagaggacaggtatcggatcgaaactccgatt
gcccggggtggtatgtctaccgtgtacaggtgccttgatcttcgtttaggacgttccatg
gcgcttaaagtcatggaagaagatttcgttgatgatcccattttccggcagcgtttccgt
agggaagctcggtcaatggcgcagctaaatcatccaaatttggtcaatgtgtatgatttt
tccgctactgacggtttggtgtatctggtgatggagttaatcactggcggcaccttgcgt
gagttgctggctgagcggggacctatgcccccgcatgctgctgtgggcgttatgcgtggg
gtgctcacgggtctcgcggctgcccaccgggcgggcatggtgcaccgggatatcaagcct
gacaacgtgttgatcaatagtgatcaccaggtgaaactgtctgatttcggtttggttcga
gcggctcacgccggccagtctcaggacaatcagattgtgggcacggtggcttatctttcc
cctgagcaggttgagggcggtgagatcgggccggccagcgacgtgtattcggcaggcatt
gtgctctttgagctgctcacaggcaccacgcctttttcgggcgaggatgatctcgaccat
gcatacgcccgccttacggaagtcgtgccggcaccgagttcgcttatcgacggcgtcccc
tccctcatcgatgagcttgtcgcgacagctacctccattaatcctgaggatcgtttcgat
gattctggagagtttttgtccgcactggaagatgtggcaacagagttgagcttgccggct
ttccgggtccctgtgccggttaattccgcagccaatagggctaatgcccaggtcccggat
gctcagccaactgatatgtttaccacccatatccccaagactcctgagcctgatcacact
gcgatcattccggtggcctcagcaaatgagacgtcgattctgcctgcgcaaaacatggga
caaaacatggcacaaaatatggcgcagaatccgctgcaacctccggaacctgatttcgcc
ccggagccacctccggacacagcgctgaatattcaagatcaagagcttgcgcgcgccgat
gagccagaaattaataccgtcagcaatcgttccaaattgaagctgacgttgtggtcaatt
ttcgtggtcgcagtgatcgctgctgttgctgttggcggttggtggttcggttcaggccgt
tacggtgagattccgcaggtgttgggcatggatgaggtccaagcggtcgctgttgtagag
gaagctggtttcgtggcagtggctgaacctcagtatgacaatgaggttcccactggttcg
attattgggactgaaccttcttttggtgagcgccttcctcgcggcgaggatgtttctgtc
ctcgtctctcaagggcgtcccgtggtgccggatcttagcgaggatcgatccttaagcacc
gttcgtgaagagttggagcagcgcacgttcgtctgggttgatggcccaggtgaatattct
gacgatgttccagaaggacaagtagtttcttttacaccatcgtctggcacgcagcttgat
gttggtgaaaccgtgcagatccatttgagccgaggccccgccccggttgagattcctgat
gtctctggcatgggagtggatcaggcaacacgtgtgttggagcgcgcaggtttgagcgtc
gagcgcactgaggaaggctttgatgctgagacaccaaacggtgatgtctacgggacgtcc
cctcaggtgtccactgaagtcaagcgcggaacctctgttgtactgcagatttccaatgcc
atttcagtacctgatgtagtgggtatgaccaaggacgaagccaccgcggcgcttgcggaa
gaaggattggtcgtggcgtcgacaagcattattcccggtgaggcggcgagctccgctgac
accgtcgttaccgtcgagcctgaatccggcagccgcgttgatccagcgcatccgcaggtc
agcctcgggttagctggggagattcaagttccaagcgtggttggacgtaaggttagcgat
gctcgaagcattctggaagaagccggtttaacgctgacaactgatgcggacgacaacgat
cgaatttatagtcaaacccctcgtgcacgcagcgaagtctcggtagggggagaagttaca
gtaagggcgttttag

DBGET integrated database retrieval system