KEGG   Candida glabrata: CAGL0A04829gHelp
Entry
CAGL0A04829g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cgr  Candida glabrata
Pathway
cgr00010  Glycolysis / Gluconeogenesis
cgr00051  Fructose and mannose metabolism
cgr00052  Galactose metabolism
cgr00500  Starch and sucrose metabolism
cgr00520  Amino sugar and nucleotide sugar metabolism
cgr01100  Metabolic pathways
cgr01110  Biosynthesis of secondary metabolites
cgr01130  Biosynthesis of antibiotics
cgr01200  Carbon metabolism
Module
cgr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cgr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAGL0A04829g
   00051 Fructose and mannose metabolism
    CAGL0A04829g
   00052 Galactose metabolism
    CAGL0A04829g
   00500 Starch and sucrose metabolism
    CAGL0A04829g
   00520 Amino sugar and nucleotide sugar metabolism
    CAGL0A04829g
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CAGL0A04829g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cgr04131]
    CAGL0A04829g
Enzymes [BR:cgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CAGL0A04829g
Membrane trafficking [BR:cgr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CAGL0A04829g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N CoA_transf_3
Motif
Other DBs
NCBI-GeneID: 2886356
NCBI-ProteinID: XP_444978
UniProt: Q6FXT8
LinkDB All DBs
Position
A:complement(470791..472251)
Genome map
AA seq 486 aa AA seqDB search
MVHLGPKKPPTRKGSMVDMPQQLLDQIKVFEEMYTVDGETLRKVTKHFITELDKGLSKKG
GNIPMIPGWVMEYPSGKEKGDYLAIDLGGTNLRVVLVKLGGDRTFDTTQSKYKLPEAMRT
TKNHEELWSFIADSLQAFLEDQFPEGVKGKLPLGFTFSYPASQDRINQGVLQRWTKGFDI
PNVEGHDVVPMLQKQIEKRNLPIDIVALINDTTGTLVASLYTDGETKMGVIFGTGVNGAY
YDVVSDIPKLEGKLADDIPNDSPMAINCEYGSFDNEHVVLPRNKYDLIIDEESPRPGQQA
FEKMSSGYYLGEMLRLALLDLYDQGLILKGQDISKLKKPYVMDTSYPSKIEDDPFENLED
TDELLQKNLGIQTTVQERKLIRRLCELIGTRSARLSVCGIAAICQKRGYETAHIAADGSV
FKMYPGFKEKAAQGLADIYGWEHKDPKDCPIVIVDAEDGSGAGAAIIAALAEKRIAEGKS
LGVLGA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggttcatctaggtccaaagaagccaccaacgagaaagggttccatggtggacatgcca
caacaacttctagatcaaatcaaggtctttgaagaaatgtacactgttgatggtgaaact
ttgagaaaggttacaaagcacttcattacagaacttgacaagggtttgtctaaaaagggt
ggtaacattcctatgattccaggttgggttatggaatacccatctggtaaggaaaagggt
gactacttggccattgacttgggtggaaccaacttgagagttgttttggttaagttgggt
ggtgaccgtacttttgacactactcagtctaagtacaagctaccagaagctatgagaaca
actaagaatcatgaagaactatggagtttcattgctgattctctacaagcattcttggaa
gatcaattcccagaaggtgtcaagggtaagctacctttgggtttcaccttctcttaccca
gcttctcaagatagaattaaccaaggtgttctacaaagatggactaagggtttcgatatt
ccaaacgtcgaaggtcatgacgtcgttccaatgctacaaaagcaaatcgaaaagagaaac
ttgccaatcgacatcgttgccttgattaacgatactactggtaccttagttgcatcattg
tacactgatggtgaaactaaaatgggtgttatcttcggtactggtgtcaatggtgcttac
tacgatgttgtttctgatattccaaagttggaaggtaagttggctgatgatattccaaat
gattcaccaatggctatcaactgtgaatatggttctttcgataacgaacacgttgttttg
ccaagaaacaagtatgacttgatcattgatgaagaatctccaagaccaggccaacaagcc
tttgaaaagatgtcttcaggttattacttgggtgaaatgttgcgtctagctctgttggac
ctatacgatcaaggtttgattttgaagggtcaagacatttctaagttgaagaagccatac
gtaatggatacttcttacccatccaagattgaagacgatccatttgaaaacttggaagac
actgacgaacttctacaaaagaacctgggtattcaaaccacagtccaagaacgtaagttg
attagacgtctgtgtgaattgattggtactagatctgctagattgtctgtctgtggtatt
gctgccatctgtcaaaagagaggttacgaaaccgctcacattgctgccgatggttccgtt
ttcaagatgtacccaggcttcaaggagaaggctgctcaaggtttggctgatatttacggt
tgggaacataaagatccaaaggattgtccaattgtcattgttgatgctgaagatggttct
ggtgctggtgccgccatcattgctgctttggctgaaaagagaattgctgagggtaagtcc
ttgggtgtcttgggtgcttaa

DBGET integrated database retrieval system