KEGG   Candida glabrata: CAGL0B01529gHelp
Entry
CAGL0B01529g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K13341  peroxin-7
Organism
cgr  Candida glabrata
Pathway
cgr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CAGL0B01529g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 2886673
NCBI-ProteinID: XP_445036
UniProt: Q6FXA3
LinkDB All DBs
Position
B:137174..138283
Genome map
AA seq 369 aa AA seqDB search
MLRYQTTGFSGYGVQYSPYYDNILAVNTGSNFGLVGNGKLFILEIDNNGVVKEKNSFLTK
DCLFDSAWNELKPNQVVVAQGDGSLRLFDTTLQKFPIAMFHEHSKEVYSCNWNLVSKSNF
VSSSWDGQVKIWSPNRKASLITFSPHPIDVSRALDNLPEVSQRDKLSPNQVAQNRNCIYQ
ATFSPHDDNLILCCAGNSYVTLFDLRQNPGNNQKNFIAHRGKGALSCDFNKYRPNIIATS
GVDNSIGIWDIRMLPNSSNQQGFQTGTLVNEIVNAHDLAVKKVCWSPHHSDILLSTSYDM
SCKIWKDVSVQNNVPTGKTNGSLLSNGLLSNFKHHTEFVFGADWSLWGIPGYVATAGWDS
NVFIWNGLQ
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgctccgctatcaaacaacgggattcagtggatacggtgtacaatattcaccatactac
gataatatactagctgtgaacactgggtcaaattttggattggttgggaatggtaagtta
ttcatactcgaaattgataataatggtgtagtgaaggagaagaattcgtttcttacaaaa
gactgcctatttgactctgcatggaatgaattgaaacccaatcaggtagttgtggcacaa
ggtgacggctctttaagactatttgacactactttacagaaatttcccattgctatgttc
catgaacatagcaaagaggtttatagttgcaactggaatttagtgagtaagtctaatttt
gtcagcagttcgtgggatggccaagtaaagatctggtcgccaaacaggaaggcaagttta
ataacgttctccccacaccctatcgatgtctcaagagctttagataatttaccggaagtt
tcgcagagggataaactttcaccaaatcaagtagctcaaaatagaaattgtatctaccag
gcgacattttcgcctcatgatgataaccttattttatgttgtgcgggaaactcatatgta
acactatttgatcttcgacaaaaccctggaaacaatcaaaagaactttattgctcatagg
ggaaaaggtgccctctcatgcgacttcaataaatacagaccaaatataattgcaacttct
ggggttgataacagtattggcatatgggatataagaatgctacctaactcgtcaaatcaa
caagggtttcagacaggcactttggttaacgaaattgttaatgcacacgatttggcggtt
aagaaagtttgctggtcacctcaccactcagatatactcttatccacatcctatgacatg
tcttgtaagatttggaaggatgtatctgtacagaataatgtaccaactggtaagacaaac
ggctctttactatccaatggacttctttcaaacttcaaacaccacaccgaatttgtattt
ggtgccgattggagtttatggggtataccaggatatgttgccactgctgggtgggattct
aacgtattcatatggaacggcctacaatag

DBGET integrated database retrieval system