KEGG   Candida glabrata: CAGL0B01551gHelp
Entry
CAGL0B01551g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
Organism
cgr  Candida glabrata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dopey_N
Motif
Other DBs
NCBI-GeneID: 2886644
NCBI-ProteinID: XP_445037
UniProt: Q6FXA2
LinkDB All DBs
Position
B:138826..143916
Genome map
AA seq 1696 aa AA seqDB search
MSLPLKPLTLDSNSKQLDSRQKKFCSNVEKAIKKFDLVNEWADYIASLGTLLKALQSWSP
KFQNVKYFVPYPYDVSRRLSSSLSPSLPAGVHLKTLEVYTYIFENIGIEALAHECNIWIP
GILPLMTYASMSVRSRVIELYDNYILTLPSEILKVIIRPLLSSLFPGLEDESSEYLDQTI
KLIETLQENLGDDSLFWQTCFLVISTYSDRRAGGLVWLTRKFPSLNAIPHKIAERNKIKV
NSTGGSTNSMQDRKKVKEDALATLLPSAKNLVTPEPGLLIRCLVSCLEPENDILIKRGIL
DLLLQRVRIDSPVIQVLISPEDKKLLIMSCCKTTLNKDMSLNRRVWNWCLGFSSSTTRSS
NGSTTSVNSGASDKGDNSQDKSNEYFRTNGLLCLKQGIEDLLYNETDVVTAFKLCISIMD
RWEIGSMIIPTIFTNLLLASYKMKENELVMKAAGVFFDAVETNIIWGNVINHFFITNDIF
LIQFVINNFNISTDEEIIVNHLPLVLLSLLTEYEIFAELDGAKQTQYYNLCYNILTVIPE
RAFTTISNSTVMDISHISDGSVIEAIKCYYGKVSDPSSFMISDANSIERPYSMEVMTALI
LNKTTNIVLSQLHNQLHLNDATKLFIYTYEKIPESNQQAKKIDTIDDELSNTVFGSLKKI
TETDMEYISGLVDLFGNYLCKRMDFIESIKLLNLLVQSLWPFLKVPKSQDPAIRCLESIE
RSIPTDYVESAVANAFAKEESLNVRIDVLNLLWISLPQTSTLYIRPLEIIFDELNNSQNP
YYLSVSKWIYSLNTAGTINNLFRIIMNQLSEFEFFKRDTIKETDDLDMFTYRIQIIKNVL
STNNHSILKTFASEINTTVMIKTLGNEDVSTYKSCCVAIIINFLKKQNNTHPRSIRSSLV
LLDLLLDGSEANFKEIVIFLLEKSSFYISQGEIESELIAVALIDIVSKVLMISHQNGIKL
DIFDDNSTHLKYIDYLVTSVSTMEGPFIVTAYVKLLSESIAYFENSIFRTILPLTASMVQ
CIGRLFEKEKESGGYLEPILLLLGGLEELLEVSHGFLTAGEKDNYFGNTAKSDFLQSVVS
NVFSSENTAVDIKIQGERDVIIQSFKQVTNSAYRIWSWAHIQSRISLKSNPSNSGTHANY
KLKFGAKKLLEKLYILEPLETLETLISTNKNETTVPLIQALDGNRPALTIPSYFSSIVLR
CNKNSTVRFSSNTSSKTTTFKGMKSDPSLLNKLHADAIMQNLLDYVKTLENTAMEDFYGD
YILFLKEVSNNQYLYKNVCLQVMDLCVVIADKLSRSKFGEQKRPRKDLSDLCFKYIPAAV
EGLAKSKENYNHILETLTKVTRNITLLLNENESGDKVHAVITSIISNIVVPHLKTEDAVF
SMPEFMSLLTELVKVSGRVKLWRQVIGDAFNDDTVLIEILQNIKWQDIIFKWSDYEEHKY
KLLSDLTMLVTTKKSALAPTAISFNSWGDSEDNTKKKNVLRIAYLLMISPKDYYLMHFEP
LISYALSTLSSQEHTFKSEFWALLRVIFMKFSLSHFTSTWPLISYALQTNLQEFYENIQI
QNFTNPEATFQLCKTLDQLLAMNIEGFCATNEWIFIIDTINCIYKTNSYVALADSIASCK
EFEITTMDDLNLSKNISSFKPLLLGVHKIDRHNQLRSFFQNLSYVHYESTYMMVKFDTNE
FLNDTNSDLLYLIKKS
NT seq 5091 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgccactcaaacctttgacgctagattctaatagcaaacagttggatagcaga
cagaagaagttttgctcaaatgttgaaaaggcaattaagaaattcgatttggtgaacgag
tgggcggattacattgccagtttgggtacccttttgaaagcattacaaagctggtctcct
aaatttcagaacgtcaagtactttgtcccttacccatacgatgtaagtagacgattatcc
tcatcattgtcaccttctttacctgcaggtgtgcatctgaagactttagaagtatacacc
tacatctttgaaaacattggaattgaagctttggcccatgagtgcaatatatggatacca
ggtatcttacctttaatgacatatgcgtcaatgtcagttcgatctagagtaattgaacta
tatgataattatatcttaactctgccgtcagaaattttgaaagttattataaggccatta
ttgtccagtttgtttcccggcttagaggatgaaagtagcgagtatctggatcaaacaata
aaattaattgaaacactacaggaaaaccttggtgatgattcactattttggcaaacatgc
tttttagttatctcaacatacagtgatagaagagcaggtggcttggtttggctgaccaga
aaatttccatcactaaatgctataccacataaaatcgccgaacgtaataaaatcaaggtc
aatagtacaggaggctccacaaatagcatgcaagatagaaagaaggtaaaggaagatgct
ttagctactttactcccatcagcaaagaatttagtcacccctgaacctggccttctaata
aggtgccttgtcagttgcttagaaccagaaaacgatattcttatcaaaagagggatactt
gatctacttttgcaacgagtaagaatagactcgccagttattcaagtattaatcagtccc
gaagacaaaaaacttttaattatgtcctgttgcaagacaacattaaataaggatatgtct
cttaatagacgtgtttggaattggtgtctcggattctcctcttcaacaaccagaagttcc
aatgggagtaccacaagtgttaatagtggagcttcagataaaggagataattctcaggat
aagtcgaatgaatactttaggactaatggccttttgtgtttgaagcaaggtatagaggac
ctgctttataatgagactgatgttgttactgctttcaagctatgcatatcaataatggac
agatgggagatagggtcgatgataattccaaccatattcactaatctattattagcgagc
tataaaatgaaagaaaatgaattagtaatgaaggcagctggtgttttttttgatgcagta
gaaacaaatataatatggggaaatgttatcaaccacttttttattaccaatgatatcttc
ttaatacagtttgttatcaataattttaacatttcgactgatgaggaaattattgttaat
catttaccgttggtactgttaagcttattaaccgagtatgagatatttgctgaacttgat
ggcgccaaacaaacacagtattataatttgtgttataacatattgactgtcattccagaa
agagcttttacaaccatatcaaattcaactgttatggacatctcgcacatttcggacgga
tcagtaattgaggctataaaatgctactatggaaaagtatctgatccatcttcgtttatg
atttctgatgcaaatagcattgaaagaccgtatagcatggaagttatgacagcgttaata
ctaaacaaaaccacaaatattgtgctgtctcaattacacaaccaattacatctcaatgat
gctacaaaacttttcatatacacttatgagaagatcccagagtccaatcaacaggccaaa
aaaattgatactattgatgatgaattgagtaacacagtgtttggaagcttaaagaaaatt
actgaaactgatatggaatatatctctggacttgtagatttattcggaaattatctgtgc
aagcgtatggattttattgaatccatcaaacttttaaatttgttagtacagtcattatgg
ccattcttgaaggtacccaaaagtcaagaccctgctataaggtgccttgaatcaattgaa
aggtctatcccaacagactatgtggaatcggcggtcgcaaatgcgtttgcaaaagaggaa
tctttgaatgttagaattgacgttttaaatttactatggattagtttgccacaaacgtcc
accctctacattagacccttggaaattatttttgatgagctaaataactcacaaaatcca
tactatctgtctgtttccaaatggatttattcactgaatacggctggaaccatcaataat
ttatttagaatcatcatgaatcagctttctgaatttgaatttttcaaaagagacactatt
aaagagactgatgatttggacatgtttacttaccgaatccagattattaagaatgtactc
agtactaataaccattcaattttaaaaacttttgcttctgaaatcaacactactgttatg
ataaaaacactaggaaatgaggatgtttctacatataagagctgctgtgtggccatcata
ataaactttttaaagaagcaaaataacacccatcctagaagtattaggagttcattagtt
ttactcgatttgctgctggacggttcggaggcgaacttcaaagaaattgtaatatttctt
ttagaaaaatcatcattctatatttcgcaaggggaaattgaatctgaattgattgccgtt
gctctaattgatatcgtttctaaggtattgatgatatctcatcaaaatggaattaaactg
gatattttcgacgacaatagtactcatttgaagtatattgattatttagtaaccagtgtt
tccaccatggaagggccattcattgttacagcttatgttaagttactatccgagagtatc
gcatactttgagaactcaatttttagaacgatccttccacttactgcttcaatggtccaa
tgtataggaagattatttgaaaaggagaaggagtcagggggttaccttgaaccaatattg
cttttgctaggaggattagaggagttattagaggtatctcacggttttttaacagcaggt
gaaaaagacaattactttggtaatactgcaaaatcggattttttacagtcagttgtatca
aacgttttctcttccgaaaacaccgccgtagatataaagattcaaggtgagagagatgtg
atcatccagtctttcaaacaagttactaatagtgcctacagaatttggtcttgggctcac
atccaatctagaatatcattaaaatcaaatccatcgaattcgggaacacacgcaaactat
aaattgaaatttggtgccaaaaaattattggagaaattgtacattttggaaccacttgaa
acactagaaactttaataagcaccaataaaaatgaaacaacagttcctctaatccaagcc
ttggatggtaatcgtcctgccttaactattccttcttacttttcaagtatagtcctacgt
tgcaacaaaaattccacggtaaggttttcctccaatacttcttccaaaacaacaacattt
aaaggaatgaaatctgatccatcccttctaaataaattacatgcagatgccattatgcaa
aacctactagactatgtcaagacattggagaatacggcaatggaggatttttatggtgac
tatattttatttttaaaagaggtttctaacaatcaatatctatacaaaaatgtttgctta
caggtgatggatttatgcgttgttattgcggataaactttcaaggtccaagtttggtgaa
caaaaaagaccaagaaaagatctttctgatttgtgcttcaagtatatccctgctgcagta
gaagggctggcaaagagtaaagaaaactacaaccatattttggaaactctaacaaaggtt
actagaaatataaccttacttctcaatgaaaatgaatctggtgataaggttcatgctgtt
attacgtctattatatcaaacattgttgtaccacatttgaaaacggaggatgctgttttt
agcatgccagaatttatgtctcttcttactgaattggtaaaagttagtggtcgagtaaag
ctatggagacaagttatcggagatgcattcaatgatgacacagtacttattgaaatactt
caaaacataaaatggcaagatatcatatttaaatggtcagattatgaggaacataagtac
aaacttctttctgatttgacaatgttagtaactacaaaaaaatctgccttggctccaacc
gcaatttcttttaactcttggggtgattcagaagacaatacaaaaaagaaaaatgtttta
agaatagcttatcttctcatgattagtccaaaagactactacttgatgcattttgaaccg
cttatttcatatgcactatctactctttcgtcacaggaacatactttcaagtccgaattc
tgggcattgttgagagtaatttttatgaagttttccttatcccattttacctcaacttgg
cctctgatcagctatgccttacaaacaaatcttcaagagttttatgaaaatatccaaatc
caaaatttcactaacccagaggccacatttcagttatgtaaaacgcttgatcaactatta
gcaatgaatatagagggtttctgtgctacaaatgaatggatttttattattgataccata
aactgtatttacaagacgaactcatatgtcgccttggctgattcaattgcatcttgcaaa
gaatttgagataactactatggatgatctaaatttatcgaagaacatatcttcgttcaaa
ccattattattgggagttcacaaaattgacagacataaccagttacgcagttttttccaa
aacctgagctacgtccattatgaaagcacttatatgatggtcaagtttgatacaaacgaa
ttcttgaatgatactaatagtgacctattatatctgataaaaaaatcatga

DBGET integrated database retrieval system