KEGG   Candida glabrata: CAGL0B01573gHelp
Entry
CAGL0B01573g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K19589  release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
cgr  Candida glabrata
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cgr03012]
    CAGL0B01573g
Enzymes [BR:cgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     CAGL0B01573g
Translation factors [BR:cgr03012]
 Eukaryotic Type
  Release factors
   CAGL0B01573g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_33 Methyltransf_31 Methyltransf_23 PrmA Met_10 Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 2886663
NCBI-ProteinID: XP_445038
UniProt: Q6FXA1
LinkDB All DBs
Position
B:complement(144100..144771)
Genome map
AA seq 223 aa AA seqDB search
MLPTPYVKCDYEKVYEPSEDSFLLLDILEKERQYLADRFSKSLNVVCEIGVGSGIVTTFM
MQNTIPSAGHLNLYYAIDVNPWALESTLTTADINNCKKSYLEPVQADLTSSFRTREIDLL
IFNPPYVPAEDVPTIPEETDDQDKWLDLALLGGEDGMDVTNKVLDNLEAILSLRGVAYIL
FCARNKPEEIAKRMEQIWDIKLIEQRKAGWEILSVYRFQKKNL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcttccgacaccctatgtgaaatgcgattatgaaaaggtttacgaaccatcagaagat
tctttcttacttctggatattctggaaaaggaaagacaataccttgctgacagattcagt
aagtccctgaatgttgtatgtgaaattggtgtgggctcaggtattgtaactacatttatg
atgcaaaatacaattccgagcgctggtcacttgaatttgtactatgctattgatgtaaat
ccatgggctttagaatctactctaaccacggcagatatcaataactgtaagaaatcatat
ctggagcctgtacaggcagatctcacgagcagctttagaactagagaaatcgaccttctt
atattcaatccaccatatgtacctgctgaggatgtacctactattccagaagaaaccgat
gatcaagataaatggttggacttggcgttgttggggggtgaagatggaatggacgtgact
aataaagtgctcgacaacctagaagcaatattgtctttgaggggggtagcatatatttta
ttttgtgccagaaataagccggaagagatagctaaaaggatggaacaaatttgggatatc
aaattgatagaacaaaggaaggcgggctgggaaatattaagtgtttatcgcttccagaag
aagaatctatga

DBGET integrated database retrieval system