KEGG   Candida glabrata: CAGL0B01589gHelp
Entry
CAGL0B01589g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K12158  ubiquitin-like protein Nedd8
Organism
cgr  Candida glabrata
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cgr04121]
    CAGL0B01589g
Ubiquitin system [BR:cgr04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   CAGL0B01589g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ubiquitin Rad60-SLD TBK1_ULD Ubiquitin_2 Cas9_b_hairpin TUG-UBL1
Motif
Other DBs
NCBI-GeneID: 9487962
NCBI-ProteinID: XP_002999515
UniProt: B4UMX4
LinkDB All DBs
Position
B:join(145132..145280,145404..145488)
Genome map
AA seq 77 aa AA seqDB search
MIIKVKTLTGKEIPVEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTAK
LSDGMQLHLVLTLRGGN
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgattattaaggtgaaaacattgacagggaaggagattccagtggaagtgagtggagag
gacaaagtgtaccacataaaagagctattggaagagaaagaaggtattccggcatcccag
cagagactgatattccacgggaaacaaataaataatgacgatacgatatccaccgctaag
ttatcagatggcatgcaactgcatctggtgttgacactgagaggcggaaactga

DBGET integrated database retrieval system