KEGG   Candida glabrata: CAGL0C03223gHelp
Entry
CAGL0C03223g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cgr  Candida glabrata
Pathway
cgr00020  Citrate cycle (TCA cycle)
cgr00190  Oxidative phosphorylation
cgr01100  Metabolic pathways
cgr01110  Biosynthesis of secondary metabolites
cgr01130  Biosynthesis of antibiotics
cgr01200  Carbon metabolism
Module
cgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cgr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAGL0C03223g
  Energy metabolism
   00190 Oxidative phosphorylation
    CAGL0C03223g
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CAGL0C03223g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9
Motif
Other DBs
NCBI-GeneID: 2886893
NCBI-ProteinID: XP_445316
UniProt: Q6FWS8
LinkDB All DBs
Position
C:321831..322592
Genome map
AA seq 253 aa AA seqDB search
MFMLRVSRRGLATATSVPRLKTFKIYRWNPDKPTEKPHLQEYKVDLEDCGPMVLDALLKI
KNEQDATLTFRRSCREGICGSCAMNIGGANTLACLCKIDQDESKTTKIYPLPHMFIVKDL
VPDLTGFYQQYKSIQPYLQRTDYPADGKEVLQSIDDRKKLDGLYECILCACCSTSCPSYW
WNQEEYLGPAVLMQAYRWLIDSRDQATKARRTMLQNSMSLYRCHTIMNCTRTCPKGLNPG
RSIAEIKKQLAFD
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtttatgctaagagtctccaggagagggttggctactgccactagtgtgcctcggtta
aagacgttcaagatttatagatggaaccctgataaacccactgagaaaccacatctgcaa
gagtacaaagtcgacctggaagactgtggtcccatggtgctggacgctttgctgaagatt
aagaatgagcaggatgccactttgaccttcagaagatcctgcagagaaggtatctgtggt
tcctgtgccatgaacatcggcggtgccaacacgctggcctgtctgtgcaaaatcgaccag
gacgagagcaagaccacgaagatatacccactgcctcacatgttcatcgtcaaggacctg
gtcccagacttaacaggtttctaccagcagtacaagtccatccagccttacttgcaaaga
acagattaccctgcagacggtaaggaagtgctgcagtccatcgacgaccgtaagaagctg
gacggtctgtacgagtgtatattatgtgcatgctgttccacctcgtgtccttcctactgg
tggaaccaagaagaatacctgggtcctgccgtcttgatgcaggcatacaggtggttgatc
gactccagagaccaggccaccaaggccagaagaacaatgctgcagaactcaatgtccctg
tacagatgccacaccatcatgaactgtaccagaacatgtcctaagggtctaaaccctggc
cgctcaatcgcggaaatcaagaagcaattggccttcgactaa

DBGET integrated database retrieval system