KEGG   Candida glabrata: CAGL0C04741gHelp
Entry
CAGL0C04741g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cgr  Candida glabrata
Pathway
cgr04146  Peroxisome
cgr04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CAGL0C04741g
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    CAGL0C04741g
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CAGL0C04741g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 2886862
NCBI-ProteinID: XP_445379
UniProt: Q6FWL5
LinkDB All DBs
Position
C:complement(443733..444197)
Genome map
AA seq 154 aa AA seqDB search
MVKAVAVLRGSAGVSGVVTLEQASEQDPTTITYEIAGNDPNAERGFHIHEFGDVTNGCVS
AGPHFNPFKKTHGAPQDENRHVGDLGNIKTDAQGVAKGVITDSLVKLIGPTSVVGRSVVV
HAGTDDLGKGGNEESLKTGNAGPRPACGVIGLTN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagctgttgctgttttgagaggaagtgccggtgtctccggtgtggttactttg
gagcaagcctccgaacaggaccctaccactatcacctacgagattgcaggcaacgaccct
aacgctgagcgtggtttccacatccacgagttcggtgacgttaccaacggctgtgtctcc
gctggccctcacttcaaccctttcaagaagacccacggtgcgccacaggacgagaacaga
cacgtcggtgacttgggaaacatcaagaccgacgcccagggtgtcgccaagggtgtcatc
accgacagcctcgtcaagctgatcggccctacctccgtcgtcggcagatccgtcgtcgtc
cacgccggtactgacgacctcggcaagggcggtaacgaggagtccctgaagactggtaac
gctggcccaagaccagcctgcggtgtcatcggcctaaccaactaa

DBGET integrated database retrieval system