KEGG   Candida glabrata: CAGL0D00198gHelp
Entry
CAGL0D00198g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cgr  Candida glabrata
Pathway
cgr00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CAGL0D00198g
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CAGL0D00198g
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CAGL0D00198g
    1.1.1.-  
     CAGL0D00198g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-GeneID: 2887040
NCBI-ProteinID: XP_445422
UniProt: Q6FWH2
LinkDB All DBs
Position
D:27559..28710
Genome map
AA seq 383 aa AA seqDB search
MRSLAYFKTGDIHFTDKIDTPKINNDHELMIDVAWCGICGTDLHEFLEGPIFMPKDGDTH
YLSGLDLPLPMGHEMSGIVKEVGKGVTRFKPGDRVVIEATTSCGDTHRWPKSKVAKGELC
PACEMGLPNCCTHGSFQGLGSVGGGFAEQVVVGEKHVVKIPDKLPLDVAALVEPLSVAWH
AARLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELAEKLNVVVFNP
THTRAQNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKAACIQGHIVNVAIWGPKPVA
FHPMDMTYGEKKLTGTMGYVTRDFEEVVDAIDKGYISIEECKLLITGRVKLEDGMEKGFH
ELIEHKETNVKILLTPNNHGELQ
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagatcattagcttactttaagacaggtgatattcattttactgacaagattgatact
ccaaagatcaataatgatcatgaattgatgatcgatgtggcatggtgtggtatttgtggt
accgacctgcatgagttcttagaaggtccaattttcatgccaaaggatggagatacacat
tatctttccggacttgatctaccgctaccaatgggtcatgaaatgtcaggtattgtgaag
gaagtaggtaagggtgtgactcgctttaagcctggtgacagggttgttattgaagctacc
acaagttgtggtgatactcaccgttggccaaagtctaaagtcgctaaaggtgaactatgt
cctgcttgtgaaatgggtttaccaaattgttgcacacacggtagtttccaaggtttagga
tctgttggtggtggttttgccgaacaagttgttgttggtgaaaagcatgttgttaaaatt
ccagacaaattgccattggatgttgccgctttggttgagcctttgtctgtcgcatggcat
gccgctagattagccgaattcaaagaaggctctaatgctttggttttgggttctggtcca
attggtttggccatgattcttgctttgaagggtatgaaagctgggaagattgtggtttct
gagcctgccaaattgagaagagaactagctgagaaattgaatgtcgttgttttcaaccca
actcatacaagagcacaaaatgcaattgagaaattgaaagaactatctccaaaagatcac
ggttttgactacacctttgactgttctggtgttcaggatacattcaatgcagcagttaaa
gctgcttgtattcagggtcacattgtgaatgtggctatttggggtcccaaaccggtagcc
ttccatccaatggatatgacctatggtgagaagaagcttactggtactatgggctatgtt
accagagattttgaggaagttgttgatgccattgataagggatatatttccattgaggag
tgtaagctattgattactggtagagttaaattggaagatggtatggagaaggggttccat
gaattgattgagcataaggaaactaatgtcaagattttgttgaccccaaataatcatgga
gagttacaatga

DBGET integrated database retrieval system