KEGG   Candida glabrata: CAGL0D00770gHelp
Entry
CAGL0D00770g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cgr  Candida glabrata
Pathway
cgr00020  Citrate cycle (TCA cycle)
cgr00480  Glutathione metabolism
cgr01100  Metabolic pathways
cgr01110  Biosynthesis of secondary metabolites
cgr01130  Biosynthesis of antibiotics
cgr01200  Carbon metabolism
cgr01210  2-Oxocarboxylic acid metabolism
cgr01230  Biosynthesis of amino acids
cgr04146  Peroxisome
Module
cgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAGL0D00770g
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CAGL0D00770g
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CAGL0D00770g
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CAGL0D00770g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh NTP_transf_6
Motif
Other DBs
NCBI-GeneID: 2887212
NCBI-ProteinID: XP_445447
UniProt: Q6FWE7
LinkDB All DBs
Position
D:95715..96986
Genome map
AA seq 423 aa AA seqDB search
MLGRRCFASSAKLAKIKVKTPVVELDGDEMTRIIWDKIKKQLILPFLDVDLKYYDLSIQS
RDKTKDQITHDSAEAIKKYGVGVKCATITPDEARVKEFNLTKMWKSPNGTIRNILGGTVF
REPIVIPRVPRLVPGWEKPIIIGRHAHGDQYKATDAVIPGQGKLELVYKPNGDASKAEVM
EVYDYKGPGVALAMYNTDESIRGFAHSSFKLALQKKLNLFLSTKNTILKKYDGRFKDIFQ
EVYDSEYKQKFAELNITYEHRLIDDMVAQMIKSKGGFIMALKNYDGDVQSDIVAQGFGSL
GLMTSILITPDGKTFESEAAHGTVTRHYRKHQQGEETSTNSIASIFAWTRGLAKRGELDG
TPDVVRFANILESATLNTVQQDGIMTKDLALACGKTDRASYVTTTEFLDAVEKRLQTEIK
SID
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgctcggaagaagatgttttgcttcctctgcgaagcttgccaagatcaaagtgaagacc
ccagttgtagagctggatggtgatgagatgaccagaattatctgggacaagataaagaag
caactgatcctaccattccttgatgtcgatttgaagtactacgacttgtctatccagtcc
cgtgacaaaaccaaggaccagatcacacatgactctgctgaggctatcaagaaatatggt
gtcggtgtcaagtgtgctaccatcaccccagatgaggcccgtgttaaggagttcaatttg
accaagatgtggaagtctcctaacggtacaattagaaacatactcggtggtaccgtcttc
agagaaccaattgtcatcccaagagtccccagactggttccaggttgggaaaagccaatc
atcataggtagacacgcccatggtgaccagtacaaggctactgatgccgttatacctggt
caaggtaagctagaacttgtctacaagccaaacggcgacgcctccaaggccgaagttatg
gaagtttatgactataagggcccaggtgttgcactagcaatgtataataccgacgaatcc
atccgtggttttgcccattcgtctttcaaactagcactacaaaagaaattgaacttgttt
ttgtccactaaaaacactattctaaagaaatacgatggtagattcaaggacatcttccaa
gaggtctacgattcagagtacaaacagaagtttgctgaattgaacatcacatatgagcac
cgtctaatagatgacatggttgctcagatgatcaaatctaagggtggttttatcatggct
ttgaagaattacgatggtgatgtgcaatccgacattgttgctcaaggttttggttctcta
ggtttgatgacttctattttaatcactccagatggtaagaccttcgaaagtgaagctgct
cacggtacggtcacaagacactacagaaagcaccaacaaggtgaagaaacttctactaac
tccattgcctctatttttgcttggaccagaggtctagctaagagaggtgaattggatggt
actccagacgttgttagatttgccaacattttagaatctgcaactttgaacactgtccaa
caagatggcattatgaccaaggaccttgctttagcatgtggtaagactgatagagcttct
tatgtcactaccactgagtttttagatgcagtagaaaagagactacaaactgaaattaaa
tctattgactaa

DBGET integrated database retrieval system