KEGG   Candida glabrata: CAGL0G02717gHelp
Entry
CAGL0G02717g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
cgr  Candida glabrata
Pathway
cgr00500  Starch and sucrose metabolism
cgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CAGL0G02717g
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CAGL0G02717g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 PFU
Motif
Other DBs
NCBI-GeneID: 2888278
NCBI-ProteinID: XP_446481
UniProt: Q6FTG3
LinkDB All DBs
Position
G:complement(249013..250560)
Genome map
AA seq 515 aa AA seqDB search
MFLWIVGVLSLYVSLPFVKFLRSDAVSWHDRYVPRGNFTEWVHAQNSIALERLLDNFIDE
NGAILASPSRNEPDYYYQWVRDSAIVVNTLVKQLPAIEQNLQYDQLVHRRILQFLNNSFV
LQRLDNLSGKGVPTSIRGLGEPKFNVDNTQFNENWGRPQNDGPPLRIITILNYLQHLNNT
GKQIDHIITHNAKEGFLPFKVTKDIFDNILFWDLQFIVDEWKSENFDLWEEVRGHHFFTS
VMQLYAIERTLPIAKQNHLLRKKFVESLVDTRHKIREFILDNRTGFISKSANHIISCPEI
YGKRSGLDIATILASIYTHDGSNTSEHLDLFHVDNRYILNTLYGLTESMSDLYPINKENE
RHSKKHNLAAVALGRYPEDVYDGVGISEGNPWYLATAAAAEHMYKLARKFIEDEKSIPIS
PSDEFWKFIIETDSKDKFDVKYHSHAFNETIKSFVALGDSFLDKIRLHVADDGSMSEQIN
KYTGYNQGASDLTWSYGSYLNAYQAREEILAYLSH
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgtggattgttggagtgttgtcgctgtatgtgtcgttgccctttgtgaaattt
ctccgtagcgatgctgtctcttggcatgacaggtatgtgccaagaggtaatttcacagag
tgggtgcatgcacagaactccattgctctggagaggttgctggacaacttcatcgatgag
aacggtgccatactggcttcaccctctcgaaatgagcccgattactactaccagtgggta
agagacagtgctattgtggtcaatacattagttaaacagttgcctgcaattgaacagaac
ctgcaatatgatcaattggtgcataggaggatactccagttcttgaacaactcgtttgtg
ttgcaacgcttggataatctctccggtaaaggagttccaacttcaataagagggttgggt
gagcccaaattcaacgttgacaacacccagtttaacgaaaattggggcagaccccagaat
gatggcccacctttacgaataattaccatcttgaattacttacaacatttgaacaacaca
ggtaaacagattgatcacattattactcataatgccaaagagggtttcctacctttcaag
gtaacaaaagatatatttgacaatattctattttgggatttgcaattcatagtcgatgaa
tggaaaagtgaaaacttcgacctatgggaagaagttaggggacatcatttcttcacctct
gttatgcagctttatgcaattgagagaacattaccaatcgctaaacagaatcacttattg
agaaaaaaatttgtggaatctctggtggatactagacataagattcgtgaattcatatta
gacaataggacagggttcatttcaaaatctgctaaccacatcatatcatgcccggagatc
tatggcaagcgctcgggtttagatattgcgaccatattggctagtatttacacccatgat
ggtagtaatacatctgaacatctagacttatttcatgtggacaaccgctatatactgaat
acattatatggtctcaccgaatccatgtcagacttgtacccgataaacaaagagaacgag
aggcattcaaagaagcataatctagccgctgtggcactaggtagatatccggaggatgtg
tatgatggtgtcggaatatcagaaggtaacccatggtacttagccactgctgctgccgcc
gaacacatgtacaaacttgcaagaaaattcatagaagatgaaaaaagtattccaatttct
ccaagtgacgaattttggaaatttattatcgagacggatagtaaagataaatttgatgtg
aagtatcattcacacgcattcaatgaaacaatcaaatcatttgttgctttaggggactcg
tttctcgacaaaatcagattacatgtagccgacgatggatctatgagtgaacaaataaac
aagtacacagggtataaccaaggtgcctctgatctaacatggtcttatggttcttatttg
aatgcgtatcaagctagagaggaaattctagcttatttatcgcattga

DBGET integrated database retrieval system