KEGG   Candida glabrata: CAGL0G08712gHelp
Entry
CAGL0G08712g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cgr  Candida glabrata
Pathway
cgr00020  Citrate cycle (TCA cycle)
cgr00310  Lysine degradation
cgr00380  Tryptophan metabolism
cgr01100  Metabolic pathways
cgr01110  Biosynthesis of secondary metabolites
cgr01130  Biosynthesis of antibiotics
cgr01200  Carbon metabolism
Module
cgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAGL0G08712g
  09105 Amino acid metabolism
   00310 Lysine degradation
    CAGL0G08712g
   00380 Tryptophan metabolism
    CAGL0G08712g
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CAGL0G08712g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 2888195
NCBI-ProteinID: XP_446741
UniProt: Q6FSQ3
LinkDB All DBs
Position
G:complement(824549..827584)
Genome map
AA seq 1011 aa AA seqDB search
MLRTKAWSSSWRLANRKVLQQRTVLNTVRATAVRTYASQDNFVNTTNAAYIDEMYQAWQQ
DPSSVHASWNAYFKNMKDLKIPASQAFQAPPILLGSPQGTHEAPLSTLSGSNIDENVSVH
LKVQLLCRAYQVRGHLKAHIDPLGISFGSNKNATIPKELTLDYYGFTERDLDREINLGPG
ILPRFARDGKKSMTLREIIEHMEKLYCTSYGIEYTHIPSKEKCEWLRERIEIPTPYQYTV
DQKRQILDRLTWATSFESFLSTKFPNEKRFGLEGLEAVVPGIKTLIDRSVEMGVEDVVLG
MAHRGRLNVLSNVVRKPNESIFSEFQGTTKKDVEGSGDVKYHLGMNYQRPTTSGKYVNLS
LVANPSHLEAQDPVVLGRTRSILHAKNDLETKSKALAVLLHGDAAFAGQGVVYETMGFVN
LPEYSTGGTIHIITNNQIGFTTDPRFSRSTPYPSDLAKAIDAPIFHVNANDVEAVTYIFG
LAAEWRQTFHTDAIIDVVGWRKHGHNETDQPSFTQPLMYKQIAKTPSVIDVYTDKLLKEG
SFSKSDIEEHKKWVWGMFEEAFEKAKDYVPTPREWLTAAWEDFKSPKELATEILPHEPTK
VSEDILKNIGKTISSWPENFEVHRNLKRILNQRGKSVETGEGIDWATGEALAYGSLVLEG
HNVRVSGEDVERGTFSQRHSVLHDQASEATYTPLKNLSDKQADFTIANSSLSEYGVMGFE
YGYSLTSPENLIVWEAQFGDFANTAQVIIDQFIAGGEQKWKQRSGLVLSLPHGYDGQGPE
HSSGRLERFLQMANEDPRYFPSPEKLQRQHQDCNYQVVYPTTPANLFHILRRQQHRQFRK
PLVLFFSKQLLRHPLARSNLSEFTEGSFQWIIEDVEHGKAIGTKEETKKLVLMSGQVYTA
LHKKREQLGDKTTAFLKIEELHPFPFAQLRDTLNSYPNLEEIVWCQEEPLNMGSWNYVAP
RLQTVLKETEQYKDNVVRYCGRSPSGAVAAGNKKLHLAEEEAFLKDVFNES
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgttgagaactaaagcatggtcgtcctcttggcgtttggccaacaggaaggttctgcag
cagcgcacagttttgaacactgtcagggccactgctgtgaggacatatgcgtcccaggac
aactttgtcaacactaccaatgcagcatatattgacgaaatgtaccaggcctggcagcag
gacccatcctcggttcatgcctcctggaatgcttacttcaagaacatgaaggacttgaag
atacctgcatcccaggctttccaggccccacctatcctgttgggctcgccacaaggtact
cacgaggcaccactatccactctatccggatctaacatcgacgagaacgtctctgtgcat
ttgaaagtacagctgctgtgtagagcttaccaggtgagaggtcacttgaaagcgcatatc
gacccactgggcatctccttcggcagcaacaagaatgctactatccctaaggaattgacc
ctagattattacggattcaccgagcgtgatctcgatagagaaatcaacttgggtccaggt
attttgcctagatttgccagggacggcaagaagtccatgacacttagagaaatcattgag
cacatggaaaaactatactgtacctcttacggtatcgaatatacccacatcccatccaag
gagaagtgtgagtggctaagagaaagaatcgaaatccctaccccttaccaatacacagtt
gatcaaaaaagacaaatcttggatagactaacttgggctacttctttcgagagtttccta
tcgactaaatttccaaatgagaaaagatttggtctagaaggtctggaagccgtcgtccca
ggtattaagaccttgatcgaccgttctgtcgagatgggtgtcgaggatgttgttttgggt
atggctcaccgtggtagattgaatgttctatctaatgtggtccgtaaaccaaacgaatcc
atcttctcagaattccaaggcacaacaaagaaggacgtcgagggctctggtgatgtcaaa
taccacttgggtatgaactaccaaagaccaacaacttctggtaagtacgtcaacctatcc
ttagttgcaaatccatcccacttggaagcccaagaccctgttgtccttggtagaactaga
tccatcttacacgccaaaaatgatttagagacaaagtcgaaggcattggctgttcttctg
catggtgatgccgcttttgctggacaaggtgttgtttatgaaacaatgggtttcgttaac
ttaccagaatactccactggtggtaccattcacatcattaccaacaatcaaatcggtttc
actaccgatcctagattctccagatccacaccatacccatcagatttggcaaaagccatc
gatgctcctatcttccatgtcaatgccaatgatgtcgaagcagtgacttacatttttgga
ttagctgctgaatggagacaaacattccacactgatgccattattgatgtggttggttgg
agaaagcacggtcacaacgaaactgaccagccttcgtttactcaacctctaatgtacaag
cagattgctaagactccatccgttattgatgtctacaccgataagctactgaaagagggc
tctttcagcaaatctgacatagaagagcacaaaaaatgggtgtggggaatgtttgaagaa
gcttttgaaaaggcaaaggactacgttccaacaccaagagagtggctaactgccgcttgg
gaggatttcaagtctccaaaagaactagcaactgaaattctaccacatgaaccaacaaag
gtctcagaagatatattaaagaatatcggtaagactatctcttcttggccggaaaacttt
gaagttcacagaaacttgaagagaatcttgaatcaaagaggtaagtctgtcgaaaccggt
gaaggcattgactgggcaactggtgaagctttggcttacggttctttagtgttggaaggc
cataacgtcagagtttcgggtgaagatgtcgaaagaggtacattctctcaacgtcactcg
gttttgcacgaccaagcctctgaagccacatacactccgttaaagaacctaagcgataag
caagcagacttcactattgctaactcatctttatctgagtatggtgttatgggtttcgaa
tatggttactccttaacttctccagagaacttgattgtttgggaggcgcaatttggtgat
tttgccaacactgcgcaagttataatcgatcagtttattgctggtggtgagcaaaagtgg
aagcaacgttctggtctagttctatcattacctcatggttacgatggtcaaggtccagag
cactcttctggtagattggagagattcttgcagatggcaaatgaagacccaagatacttc
ccatctcctgaaaagctacaaagacaacaccaagattgtaactaccaagttgtttaccca
actactccagccaatttgttccacattctaagaagacaacaacaccgtcaattccgtaaa
ccactggttctcttcttctccaagcaactattgcgtcacccattggcaagatccaacttg
tctgaattcacagaaggtagcttccaatggataatagaagacgttgaacacggcaaggct
atcggtaccaaagaggaaaccaagaagttggtattgatgagtggtcaagtctacactgct
ttgcacaagaagcgtgagcaattgggtgacaagactacagctttcttaaagattgaagaa
ctacatccattcccattcgcacaactgcgtgatactttgaactcttatccaaacttggaa
gaaattgtttggtgtcaagaagagccattgaacatgggttcatggaactatgtagctcca
agactacaaactgttttgaaggaaactgagcagtacaaggacaatgttgtaagatactgt
ggtagaagcccaagtggtgctgttgctgccggtaacaagaagttgcacttggcagaagaa
gaagcattcttgaaggatgtcttcaacgaatcttga

DBGET integrated database retrieval system