KEGG   Candida glabrata: CAGL0H02585gHelp
Entry
CAGL0H02585g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cgr  Candida glabrata
Pathway
cgr00250  Alanine, aspartate and glutamate metabolism
cgr00410  beta-Alanine metabolism
cgr00430  Taurine and hypotaurine metabolism
cgr00650  Butanoate metabolism
cgr01100  Metabolic pathways
cgr01110  Biosynthesis of secondary metabolites
Module
cgr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CAGL0H02585g
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CAGL0H02585g
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CAGL0H02585g
   00430 Taurine and hypotaurine metabolism
    CAGL0H02585g
Enzymes [BR:cgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CAGL0H02585g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 2888533
NCBI-ProteinID: XP_446908
UniProt: Q6FS86
LinkDB All DBs
Position
H:complement(232974..234755)
Genome map
AA seq 593 aa AA seqDB search
MLHKHTDKQRLPVNIVDHHHIDPCLQDFKLLSKELQDIASNSEKLKALGSKENKESHLLS
MKYVIPKEGVPADQAYDMIHNELTLDGNTHLNLASFVNTSTTHEVRKLISENLTKNLADN
DEYPQLIELTQRCISMLSGLWNANPEEEPIGCATTGSSEAIMLGGLAMKKMWEKKMKAAG
RTDTSKPNIIMSSACQVALEKFARYFDVECRLVPVSRKSHHMLDPNLLWDFVDENTIGCF
VIMGTTYTGHLENVAEVGDVLTAIEKQHPEWANKDIPIHVDGASGGFIVPFAFSREQLKA
YGVPNWGFDHPRVVSINTSGHKFGLTTPGLGWVLWRDESHLAPELRFRLKYLGGVEETFG
LNFSRPGFQVVHQYYNFMNLGYDGYRDTFKRSLFVARVFAHQILRSPIFNDYFEVVSSIH
ESIDGDKVPDAANDYWENPEKYKPGVPLIAFKFSDKFQKEYPEVPQALLSHMLRTRGWII
PNYPLPHSTDGSDKCEVLRVVFRNEMSLDLAQLLLSDIQAVLRKLQGSYSGLKTISHESD
SDKRRDYVYKMLLALASPDADIGEDEDEETKEKKASKKEEIKQRLKRNYRGTC
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgttacacaagcacactgacaagcagagacttcctgttaacattgtggatcaccatcat
attgacccatgcttacaggatttcaagttactatctaaggagttgcaggatattgcctcc
aacagtgagaaattgaaggctcttggcagcaaagagaacaaagagtctcatttgctctcc
atgaaatatgtgattccaaaggaaggtgttcctgctgatcaggcctatgatatgattcat
aatgagctgacactagatggtaacacccatttgaacttggctagtttcgttaacacatct
actactcatgaggtaagaaagcttatttctgagaacttgaccaagaacttggctgataac
gacgagtatcctcaattgattgaacttactcaaagatgcatctctatgttatccggacta
tggaacgctaacccagaggaggagccaattgggtgtgctactacgggttccagtgaggct
attatgcttggtggtttggctatgaagaagatgtgggagaagaagatgaaggctgcgggg
agaactgacaccagcaagcctaacattattatgtcttcagcctgtcaagttgccttagaa
aagtttgcccgttacttcgatgttgagtgtagacttgttccagtatctaggaagagccac
catatgctggaccctaacctattgtgggactttgtcgatgagaacactattggttgtttt
gttatcatgggtaccacatacactgggcatttggaaaatgttgccgaggtcggcgatgtg
ttaaccgccatcgagaagcagcacccagaatgggccaacaaggatattccaattcatgtt
gatggtgcgtctggtggtttcattgttccgtttgcattctccagggagcaattgaaggcc
tatggtgttccaaactgggggttcgaccaccctcgtgttgttagtataaacaccagtgga
cacaagtttggtttaaccacgcctggtctcggttgggttctgtggagagatgagagtcac
ttagcacctgaactgagattccgtctaaagtacctgggtggtgttgaagagacttttggt
ctgaacttctccagaccggggttccaagttgttcaccaatactacaatttcatgaacttg
ggttacgacggttaccgtgatacatttaagagatcgctgtttgttgctagagtctttgct
caccagatcttgcgcagtccaatcttcaatgactactttgaagtcgtcagctctatccat
gagagtattgatggtgacaaggtcccagatgcagccaacgactactgggagaaccccgag
aagtacaagcctggtgtgccactgattgccttcaagttctccgataagttccagaaggag
tacccagaagtgccacaggcgctattgtcacacatgctaaggacccgtggctggatcatc
cccaactacccattgccacactccaccgatggctcagacaagtgcgaggtgctgagagtt
gtgttccgtaacgagatgtccctggacttggcacagctgctgttgtcagacatccaagcc
gtgctcagaaagctgcaaggcagttactcaggcctgaagaccatctcgcatgaatcagac
tccgacaagagacgcgactacgtctacaagatgctactggcattggcctccccagacgcc
gacatcggagaagatgaagacgaagaaaccaaggaaaagaaagcatccaagaaagaagaa
atcaaacaacgtctcaagagaaactacagaggtacttgttaa

DBGET integrated database retrieval system