KEGG   Candida glabrata: CAGL0J00847gHelp
Entry
CAGL0J00847g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cgr  Candida glabrata
Pathway
cgr00020  Citrate cycle (TCA cycle)
cgr00190  Oxidative phosphorylation
cgr01100  Metabolic pathways
cgr01110  Biosynthesis of secondary metabolites
cgr01130  Biosynthesis of antibiotics
cgr01200  Carbon metabolism
Module
cgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cgr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAGL0J00847g
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CAGL0J00847g
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CAGL0J00847g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO RtxA HI0933_like NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 2889870
NCBI-ProteinID: XP_447749
UniProt: Q6FPU5
LinkDB All DBs
Position
J:complement(89492..91624)
Genome map
AA seq 710 aa AA seqDB search
METDFSENQSETTKCEAAQCCPLYAALVPYPSLPAGSRARARARVLCGSETYIRDMLRYV
VGLGGETIHRSGEQEISKNPNTSTHKKMLRTGLRLRQLSTSCVRRHAAPAGLGAGKYNVI
DHEYDCLVVGAGGAGLRAAFGLAEAGFKTACISKLFPTRSHTVAAQGGINAALGNMHKDN
WKWHMYDTVKGSDWLGDQDAIHYMTREAPKSIIELEHYGMPFSRTEEGRIYQRAFGGQSK
EFGKGGQAYRTCAVADRTGHAMLHTLYGQALNHDCHFFIEFFAMDLLTHNGEVVGIIAYN
QEDGTIHRFRAHKTVLATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQDLEFVQFHPS
GIYGSGCLITEGARGEGGFLLNSEGERFMERYAPTAKDLASRDVVSRAMTMEIREGRGVG
KHKDHIFLQLSHLPPAVLKERLPGISETAAIFAGVDVTKQPIPVLPTVHYNMGGIPTKWT
GECLTIDENGEDKVIPGLMACGEAACVSVHGANRLGANSLLDLVVFGRAVANTVADTLQP
GTPHKPLPADLGKESLASLDAIRNASGDKTTAQIRLNMQKTMQKDVSVFRMQETLDEGVK
NITAVDKTFKDVHVTDKSMIWNSDLVETMELRNLLTCATQTAVSAAERKESRGAHAREDY
PSRDDENWRKHTLSWQQHTGDPVSIKYRKVIATTLDEAECPPVPPAVRSY
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggagacggacttctccgagaaccaatcagaaacgaccaaatgtgaagcagcgcagtgc
tgccccctctacgctgcgctagtcccctacccttcccttccagcgggctctcgggctcgg
gctcgggctcgggtgctgtgtggaagtgaaacatatataagagacatgcttcgctatgtg
gtgggactgggaggagagacaatccacagatctggagaacaggaaataagtaaaaaccca
aacacctccacccataagaaaatgttgaggacgggattgagactgagacaactatctacc
agctgcgtgaggagacacgcagcgcctgcggggctaggcgcgggcaagtacaacgttata
gaccacgagtacgactgtctggtcgtcggtgccggtggtgcggggctgcgggccgcgttc
gggctggcggaggccgggttcaagactgcgtgtatctctaagctgttccctacgagatcg
cacactgtggccgcacagggtggtatcaacgctgcgctggggaacatgcacaaggacaac
tggaagtggcacatgtacgacaccgtgaagggctcagactggctcggggaccaggacgcg
atccactacatgacgcgtgaggcgcccaagtccatcatcgagctggagcactacggtatg
cctttctcgcgtaccgaggaaggccggatctaccagagggccttcggtggccagtcgaag
gagttcggcaagggcgggcaggcgtaccgtacctgtgccgtcgcggacagaacgggccac
gcgatgctgcacacgctgtatggccaggcgctgaaccacgactgccacttcttcatcgag
ttcttcgccatggacctgctgacccacaacggcgaggtcgtcggtatcatcgcgtacaac
caggaggacggtaccatccacaggttccgcgcgcacaagaccgtgctagccaccggtggc
tacgggagagcgtacttctcctgtacctccgcgcacacctgcaccggtgacggtaacgcc
atggtctcccgtgcgggcttccccttgcaggacctcgagttcgtgcagttccacccctcc
ggtatctacggctccggctgcctgatcacagagggtgcccgtggtgaaggtggcttcctg
ctgaacagcgagggtgagcggttcatggagcgttacgcgccaaccgccaaggacctggcc
tccagagacgtcgtgtcccgtgccatgaccatggagatcagggagggcagaggtgtcggc
aagcacaaggaccacatctttttgcagctgagccacctgccacccgcggtgctgaaggaa
agactgccaggtatctccgagaccgccgccatcttcgcaggtgtcgacgtcaccaagcag
cccatcccagtgctgcccacagtccactacaacatgggtggtatccccaccaagtggacc
ggtgagtgtctcaccatcgacgagaacggcgaggacaaggtgatcccaggcctgatggcc
tgcggtgaagccgcctgtgtctccgtccacggcgccaacagactgggcgccaactccctg
ctggacctggtcgtcttcggccgtgccgtcgccaacaccgtcgcggacaccttgcagccg
ggcacaccacacaagcctctgcctgccgacctgggcaaggagtccctcgcttcgctggac
gccatcagaaacgccagcggcgacaagaccaccgcacagatcagactgaacatgcagaag
accatgcagaaggacgtctccgtgttcagaatgcaggagaccctggacgaaggtgtcaag
aacatcaccgccgtcgacaagaccttcaaggacgtacacgtcaccgacaagtccatgatc
tggaacagcgacctcgtcgagaccatggagctgcgcaacctgttgacctgcgccacacag
acagccgtctccgccgcagagagaaaggagtcccgtggtgcccacgcaagagaggactac
ccatccagagacgacgagaactggagaaagcacaccttgtcctggcaacagcacaccggc
gacccagtctccatcaagtacagaaaggtcatcgccacaaccttggacgaagccgagtgc
ccaccagtgccaccagccgtgagatcatactga

DBGET integrated database retrieval system