KEGG   Candida glabrata: CAGL0J06974gHelp
Entry
CAGL0J06974g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
cgr  Candida glabrata
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cgr03036]
    CAGL0J06974g
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CAGL0J06974g
Chromosome and associated proteins [BR:cgr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CAGL0J06974g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 2889624
NCBI-ProteinID: XP_448009
UniProt: Q6FP35
LinkDB All DBs
Position
J:667811..669847
Genome map
AA seq 678 aa AA seqDB search
MDDPLSKFFQQFQLFVQNNPNVISAARAAAQIPESAKAVIVLSPYSLSHEFSRDWVAKSY
KKTIVERPERLLAAAMGVAAAITMYPALFTLKSSHRRQSSLLSPHVLKVHGSEWPRTLLQ
LCKQSDSKLARGEVEVPDNWNAGDIYLTSRTIEALQGTIGAVETGVDSIFSGPSLEHISN
RVFVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKYGVTHAVILDFDLHHGDGTQDLC
WKRAGFKPDEHTEEDGYDEFGKKFAEFPKVGYFSMHDINSFPTESGFATKENIKNASTCI
MNSHDLNIWNVHLSRWSTEEEFAKIYKSKYRTLFAKADEFFKNSKNEMNELGKPFKGLVV
ISAGFDASEFEQTSMQRHSVNVPTSFYTMFTKDALKLAQMHCQGKVLSLLEGGYSDKAIT
SGVFSHLIGLQNQDWINEWGSEQVVKEIVRGCKPSWKPYKTKKARDVIRIWAEEVIRLGR
AMIPEFEDILFKEGLQSNPGLGDVPTSTIAQRLRKTHVKEEPTKTKELTEPPKTSTNTRK
SRNDDTKKDVPFIQQELSSEDEGEDEDYVYDEELNKTFNRTVEDITIDDISRHLETLELE
QIDENEPQELFIKKDENKQQRHLQSNGMYKIPSSKTQRFKNSQQPQSNSPPTYDDSDISM
ISHVSVARKHNTRSGRKW
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggatgatccgctgagtaagttcttccagcagttccaactgtttgttcagaacaacccc
aatgttatttctgcagccagggctgcagcccagataccggagagtgccaaagcagtgatt
gtgctttcgccgtactcgttgtctcatgaatttagcagggactgggtagcgaagtcatac
aagaaaaccatcgttgagcggcctgagcgtctgctggctgcggcgatgggtgttgccgcc
gccatcaccatgtaccctgcgctgttcacgctgaagtcttcccatagaagacaaagctcg
ctgctgtctccacatgtactcaaggttcatgggtcagagtggccgcgcacactactacaa
ctatgtaaacaatctgatagtaaattggctcgcggtgaggtagaagtccctgacaactgg
aatgcaggcgatatttatttaacctcccgcactatcgaggccttgcaaggtacaattggc
gcagttgagaccggtgtggattccatattttcaggtccttccctagagcatatcagtaac
agggttttcgttgccatacgacccccaggacaccattgccattacgcaacaccatctgga
ttctgtcttttgaataatgcccatatcggtattgaatatgccgcagacaaatacggcgtt
actcacgcagtcatactagattttgatctgcatcatggtgatggtactcaggacttgtgc
tggaagagggcgggcttcaagcctgatgaacacacagaagaggatggttacgatgaattt
ggtaagaaatttgccgagtttccaaaggtcggctatttttcaatgcatgatatcaattct
ttcccaacagaatccggctttgcaacaaaggagaatatcaagaatgcctcgacttgtata
atgaattcccatgatctaaatatatggaatgtgcatttatccagatggtccacagaggaa
gagtttgcaaaaatttacaaatctaaatatagaacattatttgcaaaagccgatgaattc
ttcaagaactcaaaaaatgaaatgaacgaactaggcaagccatttaaaggactagttgta
attagcgccggttttgatgcttctgagtttgaacaaacatctatgcaaagacattcagtt
aacgtaccaacaagtttttataccatgttcactaaggatgcactaaagttagctcaaatg
cattgccaaggaaaagtcttatcattattagaaggcggttattcagacaaagctattaca
tccggtgttttctctcacttaattggtttgcaaaaccaagattggattaatgaatggggt
tctgaacaagttgttaaagaaattgtccgtggctgtaaaccaagttggaaaccttacaaa
acaaagaaagctagagatgttattagaatttgggccgaagaggttattagattagggaga
gcaatgatccctgaatttgaagatatattattcaaagaaggtcttcagagcaaccctgga
cttggcgatgttccaacttctactattgcacagagactcagaaagacacatgttaaagaa
gagcctactaaaactaaagaattgacagaacctccaaaaacctctacgaacaccagaaag
tctcggaatgatgatactaaaaaggatgttccattcatacagcaggaactatcaagtgaa
gatgaaggagaagatgaagactatgtctatgatgaagaactgaataaaacctttaatcgt
accgttgaagatataacaattgatgatatttcaagacacttggaaactttagagttagaa
caaattgacgaaaatgagccccaagaattatttatcaaaaaggatgaaaacaagcagcaa
cgtcatcttcagagcaatgggatgtataaaataccctcctccaaaacccaacggttcaaa
aacagccagcaacctcaatcaaattcaccccccacatacgatgatagtgatatctccatg
atatctcatgtttcagttgcaagaaagcacaatacaagaagtggaagaaaatggtaa

DBGET integrated database retrieval system