KEGG   Candida glabrata: CAGL0K10626gHelp
Entry
CAGL0K10626g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
cgr  Candida glabrata
Pathway
cgr00500  Starch and sucrose metabolism
cgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CAGL0K10626g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cgr01003]
    CAGL0K10626g
Enzymes [BR:cgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CAGL0K10626g
Glycosyltransferases [BR:cgr01003]
 Polysaccharide
  Storage polysaccharide
   CAGL0K10626g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_transf_5
Motif
Other DBs
NCBI-GeneID: 2890101
NCBI-ProteinID: XP_448679
UniProt: Q6FM65
LinkDB All DBs
Position
K:complement(1032533..1034623)
Genome map
AA seq 696 aa AA seqDB search
MPRDLQNHLLFEVATEVANKVGGIYSVLKSKAPVTVAQYQDNYTLIGPLNKGTYQGEVEE
LDWEDPSIFSEELQPVQQALKYMREKGVYFVYARWLIEGAPRVILFDLDSVRYKLNEWKA
DLWSLVGIPSPENDWETNDAILLGYTVVWFLGELTQLDHKHAIIGHFHEWLAGVALPLCR
KKRIDVVTIFTTHATLLGRYLCAAGDVDFYNHLQYFDVDQEAGKRGIYHRYCIERAAAHT
ADVFTTVSQITALEAEHLLKRKPDGILPNGLNVVKFQAVHEFQNLHALKKEKINDFVRAH
FHGNFDFDLDNTLYFFIAGRYEYKNKGADMFVEALARLNYRLKMAGSKKTVVAFIIMPAQ
NNSFTVEALRSQAVVKSLENTVNEVTSLIGKRIFEHAMKFPHNGITNEIPNNLEELLKPS
DKVLLKKRVLALRRPYGELPPIVTHNMADDANDPILNQIRHVQLFNNHSDRVKVIFHPEF
LNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDL
IETNQAKDYGIYIVDRRYKAPDESVEQLVDYMEEFVNKTRRQRINQRNRTERLSDLLDWK
RMGLEYVKARQLGLRRAYPDQFKEIVGEDVNDSSMEALAGGKKLKIARPLSVPGSPRDAA
KSPSTVFMTPGDLGTIQDANNVDDYFHLSVNDNEEE
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtgatttacagaaccatcttctatttgaagttgctaccgaggtggccaacaag
gtcggtggtatttactctgtgttgaagtctaaggcaccagtgacagtggcacaataccag
gataactataccttgattggtccattgaacaaaggaacttatcaaggtgaagtcgaggag
ctggattgggaagacccttctatcttctcagaggagcttcaacctgtgcaacaggccctg
aagtacatgagagaaaaaggcgtgtactttgtctacgcccgttggttgattgaaggtgcc
cccagagtcatccttttcgatttggactccgtgcgttacaagctgaacgaatggaaggcc
gacctgtggtccctagttggaattccatccccagaaaatgattgggaaaccaatgatgca
atcttactaggttacacagtcgtgtggttcttgggtgaattgactcaattggatcacaaa
catgccattatcggtcatttccacgagtggttggctggtgtcgcattgccattgtgtaga
aagaagagaattgatgtggtgaccattttcaccacacacgctactttattgggtagatat
ctgtgtgctgcaggtgatgtagatttctacaaccatttgcaatactttgatgtggaccaa
gaggcaggcaagagaggtatctaccacagatactgtatcgaaagagctgctgctcataca
gccgatgtgtttaccactgtgtcacagattactgcacttgaagcagagcatttgttgaag
agaaagcctgatggtattcttccaaatggtttgaacgtggttaaatttcaagctgttcat
gaattccaaaacttgcatgcattaaagaaggaaaagatcaacgactttgttagagcacac
ttccacggtaactttgactttgacttggacaatactttgtacttttttattgctggtaga
tatgagtacaagaataagggtgctgatatgtttgttgaagctctggctcgtttgaactat
aggttgaaaatggctggctccaagaagaccgttgtagctttcataattatgccagctcaa
aacaattctttcactgttgaagctctaagaagtcaagctgttgttaagtccttggaaaac
acagttaacgaagtgacttccttgattggtaagagaatcttcgagcatgctatgaaattc
ccacataatggtatcaccaatgaaattccaaacaacctggaagaacttttgaagccttct
gataaagttctgttgaagaagcgtgttttggctttgagaaggccatatggtgaattgcca
ccaattgtgactcacaatatggctgatgatgccaatgatccaattctgaaccaaataaga
catgtccaattgttcaacaaccacagcgatcgtgttaaggtgatcttccatccagagttt
ttgaacgccaacaacccaatcttgggtctagattacgatgaatttgtccgtggttgtcac
ttgggtgtcttcccatcatactatgagccttggggttacacgccagctgaatgtaccgta
atgggtgtcccatccatcactactaacttatcaggtttcggtgcctatatggaagacttg
atcgaaaccaaccaagccaaggactatggtatctacatcgttgaccgtcgttacaaggca
ccagatgagtcagtggagcagctagttgactacatggaagagtttgtaaacaagaccaga
agacaaagaatcaatcaaagaaacagaaccgagagattatccgatctactggattggaag
cgtatgggtttggagtacgtaaaggccagacaattaggtcttcgtagggcttacccagac
cagttcaaggagattgttggagaagatgtgaatgattccagcatggaggcactggctggc
ggcaagaagctaaagattgccagaccactaagtgtcccaggctccccaagagacgccgcc
aagtctccaagcacagtgttcatgacccccggtgatcttggtacaatccaggacgccaac
aacgttgacgattacttccatttaagtgttaatgacaatgaggaggaatga

DBGET integrated database retrieval system