KEGG   Candida glabrata: CAGL0L06820g
Entry
CAGL0L06820g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K12766  serine/threonine-protein kinase MDS1/RIM11 [EC:2.7.11.1]
Organism
cgr  Candida glabrata
Pathway
cgr04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    CAGL0L06820g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cgr01001]
    CAGL0L06820g
Enzymes [BR:cgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CAGL0L06820g
Protein kinases [BR:cgr01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   CAGL0L06820g
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Choline_kinase FAS_meander APH Pkinase_fungal
Other DBs
NCBI-GeneID: 2890818
NCBI-ProteinID: XP_449073
UniProt: A0A0W0CB00 Q6FL21
LinkDB
Position
L:769035..770135
AA seq 366 aa
MNIEKLTGPEIVKKQVYYGHEVVNGAAKSSEPITISFPATEVVGHGSFGVVFTTVIQETN
EKVAIKKVLQDKRFKNRELEIMKMLQHRNIIDLKYYFYEIDEREDVFLNLILDYMPQSLY
QRLRHFVHQRTPMPRLEIKIYMYQLFKALNYLHHTANVCHRDIKPQNLLVDPNSWCLRLC
DFGSAKQLKPTEPNVSYICSRYYRAPELIFGATNYTNQIDIWSSGCVMAELLLGQPMFPG
ESGIDQLVEIIKILGTPTKQEICVMNPNYMEHKFPQIKPIPLAKVFKKEDEVTVDFLSNT
FKYDPTQRYHSLQCLCTPYFDEIRFGDGKIREIIKDLKLLEFDEQMELAHLGPDERGAVK
QKLHIQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgaatatcgagaagcttactgggcccgagattgtcaagaagcaggtgtactatgggcac
gaggttgttaatggtgccgccaagagcagcgagccgattacgatatcgtttccggcaacc
gaggtggtgggccacgggtcgtttggtgtagtgttcactactgtgatacaggagaccaat
gagaaagttgcgataaagaaagttctccaggacaagcggttcaagaacagagaactggag
atcatgaagatgctgcagcacaggaacatcatcgacctcaaatactacttctacgaaata
gacgagagagaggacgttttcctcaacttgatactcgattacatgccccaatccctctac
cagaggctgcgccactttgtgcatcagcggacaccaatgcccagattagagataaaaatc
tacatgtaccagctctttaaagcactaaactacttgcatcatacagctaacgtatgccac
agagatataaaaccacagaacctgctggtagacccgaactcctggtgtttgcgactatgt
gattttggtagcgccaagcagttgaaacctacagagccgaacgtatcgtacatctgctcg
agatactacagagcgccagaactgatattcggagccactaactacacaaatcaaatagat
atatggtcaagcggttgcgtgatggcggaattgctcttgggtcaaccgatgttcccaggt
gagagcggcattgaccaactagtagagattattaaaatcttgggtacccctacgaaacaa
gaaatttgcgtgatgaaccctaattacatggaacacaagttccctcaaatcaaaccaatc
ccattagctaaagtcttcaagaaagaagacgaagtaacggtggatttcctatcgaatact
ttcaagtatgaccctactcaaagataccactctttacaatgtttatgcactccgtacttc
gatgaaattagatttggcgacggaaagataagagaaataataaaagatctgaaactacta
gagtttgatgaacagatggaactagcacatcttggtcccgacgaaagaggagcggtaaag
caaaagttacatatacagtaa

DBGET integrated database retrieval system