KEGG   Cutibacterium granulosum: 4412665_00164Help
Entry
4412665_00164     CDS       T05425                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cgrn  Cutibacterium granulosum
Brite
KEGG Orthology (KO) [BR:cgrn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    4412665_00164 (ahpF)
Enzymes [BR:cgrn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     4412665_00164 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like Glutaredoxin Thi4 DAO FAD_oxidored FAD_binding_3 K_oxygenase NAD_binding_8 NAD_binding_9 FMO-like
Motif
Other DBs
NCBI-ProteinID: SNV28606
UniProt: A0A239W3F6
LinkDB All DBs
Position
1:173490..175055
Genome map
AA seq 521 aa AA seqDB search
MLDANLTTQLRSYLTMLTTDVTLVPSPYTGDDSTRVEKSRQMDELLAEIADLSDAVSVAD
PVASQYEPSFAVTRPGTDIGVRFAGLPMGHEFTSLVLALLQVGGHEIKEDEALKKAVTTV
EGHHEFVTYMSLSCVNCPTVVQALNAMSVLNPNIRHTAVEGSTFRDEVAAKGVQSVPTIF
LDGEEWGSGRMTMTEILEKLDAEAASGAHEDLSHRDPYDVLVVGAGPAGAAAGVYAARKG
IRTAVVGDRVGGQVLDTDTIDNLVSVPHTTGSELAASLNAHMADYELDLIEHQHATGLTP
GGDGFTVHLTDGNLRSRAVILATGARWRHLGVPGEEEYRTRGVTYCPHCDGPLFRGKRVA
VIGGGNSGVEAALDLAGVVEHVTVIEFLDELKADEVLLTALGKLDNVDVITGTATTSIDG
DGTTVTGLSYTDRTSGQEHSIDVSGVFVQIGLLPNTEWLSEAVELNGRGEVVIDERCRTS
VPGIFAAGDCTTQAYKQIITSMGSGATASLAAFDHLIRNQA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaccacccaactgcgcagctacctgacgatgctcaccacggac
gtgacgctcgtcccgtccccctacaccggcgacgactcgacccgcgtcgagaagtcccgt
cagatggacgagctgctcgccgagatcgccgacctgtcggacgcagtgagcgtggcagac
ccggtggcgagccagtacgagccgtccttcgccgtgacccgcccgggcaccgacatcggc
gtgcggttcgccggcctgccgatgggtcacgagttcacctcactcgtgctcgccctgctg
caggtgggcggccacgagatcaaggaggacgaggccctcaagaaggccgtcaccacggtc
gaggggcatcacgagttcgtcacctacatgtcgctgagctgcgtcaactgccccaccgtc
gtgcaggctctcaacgccatgagcgtgctcaaccccaacatcaggcacacggcggtggag
ggatcgaccttccgcgacgaggtggcggccaagggtgtgcagtcggtgccgacgatcttc
ctggacggcgaggagtggggctcgggtcggatgaccatgaccgagatcctcgagaagctg
gacgccgaggcggcatccggtgcccacgaggacctctcccaccgtgatccctacgacgtc
ctcgtcgtgggtgccggcccggccggggccgctgccggcgtctatgcggcacgcaagggg
atccgcaccgccgtggtgggcgatcgcgtcggagggcaggtgctcgacaccgacaccatc
gacaacctcgtctcggtaccgcacaccaccggcagcgaactggccgcctcgctgaacgcc
cacatggccgactacgaactcgacctcatcgaacaccagcacgccacgggtctcacgccc
ggcggggacgggttcaccgtccacctcaccgacggaaacctgcgctcgcgagccgtcatc
ctcgccaccggtgcccgttggcgtcatctgggggttcccggtgaggaggagtaccgcacc
aggggagtcacctactgcccgcactgtgacgggccactgttccggggaaagagggtcgcg
gtgattggcgggggaaattccggtgtcgaggctgccctcgacctggccggcgtcgtcgag
cacgtcaccgtcatcgaattcctcgacgaactcaaggccgacgaggtgctactcaccgcc
ctgggcaagctcgacaacgtcgacgtcatcaccggtaccgccaccacgagcatcgacggg
gacggcaccacagtcaccgggctcagctacaccgatcgcaccagtgggcaggaacactcc
atcgacgtgtcaggggtcttcgtccagatcgggttgctgcccaacaccgagtggctgtcg
gaagccgtggaactcaacggccgcggcgaggtcgtcatcgacgagcggtgccgcacttcg
gttccggggattttcgccgccggagactgcaccacccaggcatacaagcagatcatcacc
tcgatgggatcgggagcgacggccagcttggcggccttcgaccacctcatccgcaaccag
gcctga

DBGET integrated database retrieval system