KEGG   Cutibacterium granulosum: 4412665_00377Help
Entry
4412665_00377     CDS       T05425                                 

Gene name
pfkA_1
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cgrn  Cutibacterium granulosum
Pathway
cgrn00010  Glycolysis / Gluconeogenesis
cgrn00030  Pentose phosphate pathway
cgrn00051  Fructose and mannose metabolism
cgrn00052  Galactose metabolism
cgrn00680  Methane metabolism
cgrn01100  Metabolic pathways
cgrn01110  Biosynthesis of secondary metabolites
cgrn01120  Microbial metabolism in diverse environments
cgrn01130  Biosynthesis of antibiotics
cgrn01200  Carbon metabolism
cgrn01230  Biosynthesis of amino acids
cgrn03018  RNA degradation
Module
cgrn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cgrn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4412665_00377 (pfkA_1)
   00030 Pentose phosphate pathway
    4412665_00377 (pfkA_1)
   00051 Fructose and mannose metabolism
    4412665_00377 (pfkA_1)
   00052 Galactose metabolism
    4412665_00377 (pfkA_1)
  09102 Energy metabolism
   00680 Methane metabolism
    4412665_00377 (pfkA_1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4412665_00377 (pfkA_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cgrn01009]
    4412665_00377 (pfkA_1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cgrn03019]
    4412665_00377 (pfkA_1)
Enzymes [BR:cgrn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     4412665_00377 (pfkA_1)
Protein phosphatases and associated proteins [BR:cgrn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4412665_00377 (pfkA_1)
Messenger RNA biogenesis [BR:cgrn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4412665_00377 (pfkA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: SNV30204
UniProt: A0A239W915
LinkDB All DBs
Position
1:432222..434543
Genome map
AA seq 773 aa AA seqDB search
MLCPPGRSKMADVTDSDTVTPDLPPSPAVRIGILTSGGDAQGMNAAVRSVVRSALSAGAE
VFAILEGYQGMIDGGDGIREMSWDDVGSILHRGGTVIGTYRSAEMRERAGRLKAVHHLLE
RGIDRLIVIGGDGSLTGLNLLRTEWPGLLDELVASGQISQQTAEEHPNLMIAGLVGSIDN
DLVGSDMTIGADTALHHIVSAIDDLSSTAASHQRSFVVEVMGRHCGYLALMAAVAGGADY
VLVPEMPPAPGWEERMCAELRRGRQAGRRDSIVVVAEGATDREGNPIRSDYVREVLTNRL
GEDTRVTILGHVQRGGKPSAYDRWASTLQGYHAVHELLTATPDSPGRVIGTCGNRVRRLD
LMTAVHDTQQVPVLIKEGRYDEAMAMRGSSFTEMDAIFTELSEPARTAAELSGGPDSKRI
AIMHAGGPAPGMNTAAQALARLGISRGHTMLGIRNGFVGLARGDIGELTWEDVEGWTGEG
GAELGTRREMPGTGELYAISRALEDARVDGLIVVGGYAAYDTVHCMTTERDRYPAFHIPT
VCLPASIDNNLPGSEFSIGADTALNVIVDAMDKIKESGIASRRCFVVETMGKTCGYLALM
SGIAAGAERIYLNEEGISLDDLAHDVHWLRESFGNGRRIFLAVRNETASQNYTTDFIAKV
LEEESHGMYDVRQVVLGHIQQGGSPSPFDRLLATQFSYHALNLLDELLATGRDDACCIGL
SEGEIQSNNMLLMPSLVDVGTRRPREQWWLHLRKVAHTVSDEVRQPPNPSQSA
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgctctgtccacctgggcgtagcaagatggcagatgtgacagacagcgacactgtgacc
cctgaccttcccccttcccccgcagtccgcatcggcattctcaccagcggtggggacgcc
cagggcatgaatgctgccgtgcgttccgtggtgcgttcggccttgtcagcaggcgctgag
gtgttcgccatcctggaggggtaccagggcatgatcgacggcggtgacggcatccgcgag
atgagctgggacgacgtcggctcgattctgcaccgcggcggcactgtcatcggcacctat
cgcagcgccgagatgcgggagcgcgccggtcgcctcaaggcagtgcaccacctgttggag
cgcggtatcgatcggctcatcgtcatcggcggggacgggtcgctgaccggcctcaacctg
ctacgaaccgagtggccgggcctgctcgatgaactcgtcgcctccggtcagatcagccag
cagaccgccgaggagcatcccaacctcatgattgctgggctggtggggtccatcgacaac
gacctcgtcggctccgacatgacgatcggtgccgacaccgctctgcaccacatcgtctcg
gcaatcgacgacctctcctccaccgcggcaagccatcagcgatccttcgtcgtggaggtc
atgggtcgtcactgcggatatctggccctcatggctgcggtggccggtggcgccgactac
gtgctggtccccgaaatgccgccggctccaggctgggaggaacgcatgtgtgccgagctg
cgtcgggggcgacaggctggccgacgcgactcgatcgtcgtcgtcgccgagggtgccacc
gaccgcgagggcaacccgatccgctccgactacgtgcgcgaggtcctcaccaaccggctc
ggcgaggacacccgggtgacgatcctggggcacgtgcaacgtggcggcaaaccatcggcc
tacgaccgatgggcgtcgaccctgcaggggtaccacgccgtccacgagctgctcaccgcc
accccggactcccccggtcgagtcatcgggacctgcggcaaccgagtccgtcgcctcgac
ctcatgacggcggtgcacgacacccagcaggtgccggtgctcatcaaggagggtcgctac
gacgaggccatggccatgcgtggcagctcattcaccgagatggacgccatcttcaccgag
ttgtccgagccagcccgcaccgccgccgagctcagtggcggtccggactccaaacgcatc
gccatcatgcatgccggcggaccagcccccggtatgaacacggccgcccaagcccttgcc
aggttgggaatttcgcgaggtcacaccatgctgggcattcgcaacggattcgtcggcctg
gccaggggagacatcggagagctcacctgggaggacgttgaaggatggaccggtgagggc
ggtgccgagctcggcactcgccgcgagatgcccggcaccggtgagctgtacgccatcagc
cgagccctggaggacgctcgggtcgatgggctcatcgtcgtcggtggctacgccgcctac
gacaccgtccactgcatgaccaccgagcgggaccgctaccccgccttccacattccgacg
gtgtgcctgcccgcatcgatcgacaacaatctgcccggctcggagttctccatcggcgcc
gacaccgcactcaacgtcatcgtcgacgccatggacaagatcaaggagtccggtatcgcg
tcccggcgctgcttcgtcgtggagacgatgggcaagacctgcggctatctggctctcatg
tcggggattgccgcaggagccgaacggatctacctcaatgaggagggcatcagcctggac
gatctcgcccacgacgtgcactggctgcgcgaatcattcggcaacggtcgacgaatcttc
ctggcagtgcgcaacgagacagcctcgcagaactacaccaccgacttcatcgcgaaggtc
ctggaggaggagtcccacggcatgtacgacgtgcgtcaggtggttctggggcacatccag
cagggtggctcaccttccccgttcgaccggctgctcgccacacagttctcctaccatgcc
ctcaacctgcttgacgagctgctcgccaccggtcgggacgacgcctgctgcatcgggctg
agcgagggcgagatccagtcgaacaacatgttgctcatgccatccctggtggacgtcggc
acgcgtcgacctcgcgagcagtggtggttgcacctgcgcaaggtggctcacaccgtttcc
gacgaggttcgccagcctccgaacccatctcaatctgcctga

DBGET integrated database retrieval system