KEGG   Cutibacterium granulosum: 4412665_00719Help
Entry
4412665_00719     CDS       T05425                                 

Gene name
prkC_1
Definition
(GenBank) Serine/threonine-protein kinase PrkC
Organism
cgrn  Cutibacterium granulosum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Arch_flagellin Kinase-like APH Kdo
Motif
Other DBs
NCBI-ProteinID: SNV32025
UniProt: A0A239WBP8
LinkDB All DBs
Position
1:complement(867607..869601)
Genome map
AA seq 664 aa AA seqDB search
MSSALPFDFGSGYQAIRRIGQGASGRVYEGIDRVHDERIAIKILRSQLDDDPQLVQRFIH
ERLTLTELDCPRIIAVRDLIVDQGMLGIIMELATGPTLGTKLTTDGPLTPATALAVVVQV
AQALVYAHERDVVHRDIKPDNIILTTDSNAEDPGVKVADFGIAKILGGSSTTTHMVGTAH
YMAPEFISNNTLSPSVDVYALGVSLYQTLTGQLPFGTEQDNPYAVAQRHLQSIPAMIPGL
DKRVWDLISGMLTKNPAHRLSAAEVADQAFGLIPDVKNEPALTVPEGALAPHAMTMLRQP
TSLKASPDDEQRLTVKDNNPPDPIELEQLRTLDSPASATILKAGPEPDVEVLGDSVGKDT
ETKNSWWSNRTHRIIIYAAAILVAATVATVCVMLAGRHRGARQESSKKTVDGLSASLPIQ
TYPSGLSVGRSVEITGGTLKYTLTYGTIKQPLGGDVLEVIKSGDNCTNVTWDDAATVAPH
SPALTLIDAKCGWTISLKTLAQQDPVTVTATLSAKDVTISNQADLQAWLQSQAKATDEVL
NDDATNSTAYSLQRLQEMRVKVPSRVKEGSAIPVTILGTWPDGENELTPIYTTPSSPNPT
SILTDITGGKEEDLRLTDRCSGAVAITPDGHDVSALHPATCSLGAEIGNYQAQESQITIV
AKGS
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcgctcttccattcgatttcggatcggggtaccaagccatccgcaggattggg
caaggggcatctggtcgtgtctatgaggggatcgatcgggtccacgacgaacgaatcgcc
atcaagattttacgctcacagctcgatgacgatccacaactggtgcagcgattcatccat
gaacgactcaccctcaccgagctcgattgtccacgcatcatcgcggtgcgagacctcatc
gtcgaccaaggcatgctcggaatcatcatggagcttgcaaccgggcccacccttggcacc
aagctgacgaccgatgggccattgaccccagcaactgctctggcagtagtggtccaagtg
gcccaagccttggtctatgcccatgagcgtgacgtagtgcatcgcgacatcaagcccgac
aacatcatcctcaccactgactcgaatgcggaggatcctggggtgaaggtggcggacttc
ggtattgcgaagatcctcggtggttcctcaacgaccacacacatggttggtacagctcac
tacatggcgcccgagttcatctcgaacaacacgctaagtcccagcgttgacgtgtatgcc
ttgggcgtgagcctgtatcagacgttaacggggcaactgccgttcggtacggagcaggac
aatccctacgccgtggcccagcgtcatctacaatccatacctgcgatgatcccgggtctt
gacaaacgggtgtgggatctcatttccggaatgctcaccaagaatccggcgcatcgactc
agcgcagccgaagtggccgatcaggcattcggcctcatccccgatgtcaagaacgaaccg
gcgctcaccgttccggaaggagcgttggcaccacatgcgatgacgatgctacgtcaacca
acgtcgttgaaagcctctcctgacgatgaacagaggctcactgtcaaggacaacaatccc
ccagatcccatcgagttggagcaactacgcaccctcgacagcccggcatcggccaccatt
ctcaaggctggcccggaaccagacgtggaggtgttgggcgattctgtaggtaaggatacg
gagaccaagaattcttggtggtccaaccgtacccatcggatcatcatctacgcagcagca
atcctcgttgcagcgaccgtggccaccgtgtgtgtcatgctcgccgggcggcatcgggga
gcacgacaggagtcatcgaaaaaaactgttgacggactcagcgcatctctaccgatacag
acttatccgtccggtctcagcgtcggccgctcggtggagatcaccggaggcacgctgaag
tacaccctcacctacggcaccatcaagcaaccactcggtggagatgtgctcgaggtgatc
aagtcaggtgacaattgtacgaacgtcacttgggatgatgccgccacggtcgctccacac
agcccagcgctcacattgatcgacgccaagtgcggatggacgatctccctcaagaccttg
gcgcaacaggatccagtgaccgtcacggcaacgctgtccgccaaggatgtgacgatcagc
aaccaagcagacctgcaggcctggctccagagtcaagcaaaggctaccgatgaagtgctc
aacgatgacgccacgaactcaacggcgtacagcctgcagcgtcttcaggagatgcgtgtc
aaggtaccctcccgcgtcaaggaaggctctgccatccctgtgacgattctgggcacttgg
ccggatggggagaacgagctcaccccgatctacaccacgccgtccagtcccaacccgaca
agcatcctcaccgacatcacaggtggcaaagaggaagatctccgtctcactgaccggtgc
tcaggagccgtggccatcacacctgatggccatgacgtaagcgctctacacccagccacg
tgcagccttggtgcggagatcggcaactaccaagcgcaggagagccagatcaccatcgtt
gccaaagggtcgtga

DBGET integrated database retrieval system