KEGG   Corynebacterium glutamicum SCgG1: C624_02230Help
Entry
C624_02230        CDS       T02690                                 

Definition
(GenBank) succinate dehydrogenase/fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cgs  Corynebacterium glutamicum SCgG1
Pathway
cgs00020  Citrate cycle (TCA cycle)
cgs00190  Oxidative phosphorylation
cgs00650  Butanoate metabolism
cgs01100  Metabolic pathways
cgs01110  Biosynthesis of secondary metabolites
cgs01120  Microbial metabolism in diverse environments
cgs01130  Biosynthesis of antibiotics
cgs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cgs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C624_02230
   00650 Butanoate metabolism
    C624_02230
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C624_02230
Enzymes [BR:cgs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C624_02230
    1.3.5.4  fumarate reductase (quinol)
     C624_02230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4 Fer4_16 Fer4_18 Fer4_15 Fer4_4 Fer4_2 Fer4_6 Fer4_21 Fer4_3 Fer4_22 Fer4_13 Fer2
Motif
Other DBs
NCBI-ProteinID: AGN18035
LinkDB All DBs
Position
483705..484454
Genome map
AA seq 249 aa AA seqDB search
MKLTLEIWRQAGPTAEGKFETVQVDDAVAQMSILELLDHVNNKFIEEGKEPFAFASDCRE
GICGTCGLLVNGRPHGADQNKPACAQRLVSYNEGDTLKIEPLRSAAYPVIKDMVVDRSAL
DRVMEQGGYVTINAGTAPDADTLHVNHETAELALDHAACIGCGACVAACPNGAAHLFTGA
KLVHLSLLPLGKEERGLRARKMVDEMETNFGHCSLYGECADVCPAGIPLTAVAAVTKERA
RAAFRGKDD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttacacttgagatctggcgtcaggcaggcccaactgcagaaggcaagttcgaa
accgtccaggttgacgacgccgtcgcgcagatgtccatcctggagctgcttgaccacgta
aacaacaagttcatcgaagaaggcaaagaaccattcgcattcgcgtctgactgccgcgaa
ggtatctgcggtacctgtggtctcctcgtgaacggccgccctcacggcgccgaccagaat
aagcctgcctgcgcgcagcgcttggtcagctacaacgaaggcgacaccctcaagatcgaa
ccactgcgttccgccgcatacccagtgatcaaggacatggtcgtcgaccgctccgcactg
gaccgcgtcatggaacaggggggctacgtgaccatcaacgcaggtaccgcacctgacgct
gataccctccacgtcaaccacgaaaccgcagaactcgcacttgaccacgcagcctgcatc
ggctgtggtgcatgtgtcgctgcctgccctaacggcgcagcacacctgttcaccggcgca
aagcttgttcacctctccctcctcccactgggtaaggaagagcgcggactgcgtgcacgt
aagatggttgatgaaatggaaaccaacttcggacactgctccctctacggcgagtgcgca
gacgtctgccccgcaggcattccactgaccgctgtggcagctgtcaccaaggaacgtgcg
cgtgcagctttccgaggcaaagacgactag

DBGET integrated database retrieval system