KEGG   Corynebacterium glutamicum SCgG1: C624_11935Help
Entry
C624_11935        CDS       T02690                                 

Definition
(GenBank) hypothetical protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
cgs  Corynebacterium glutamicum SCgG1
Pathway
cgs02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cgs00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C624_11935
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cgs02000]
    C624_11935
Transporters [BR:cgs02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    C624_11935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_29 AAA_23 AAA_16 oligo_HPY NACHT RsgA_GTPase AAA_15 PRK AAA_24 FtsK_SpoIIIE AAA_19 SbcCD_C DUF3987 DUF87 G-alpha
Motif
Other DBs
NCBI-ProteinID: AGN19956
LinkDB All DBs
Position
complement(2583938..2585581)
Genome map
AA seq 547 aa AA seqDB search
MTTPLLEINDLVVSYQTAKGLVHAVNNVSLEVHPGQITAIVGESGSGKSTTAQAVIGLLA
DNAEVDSGRISFNGRSLVGLNAREWKNVRGTKIGLIPQDPNNSLNPVKTIGASVGEGLAI
HKRGTAAERKKKVIELLERVGIDNPEVRYDQYPHELSGGMKQRALIAAAIALEPELIIAD
EPTSALDVTVQKIILDLLEDMQRELGMGILFITHDLAVAGDRADQIVVMQKGEVRESGYA
ASVLTDPQHEYSKKLLADAPSLTIGEIPTRVPAIDPEVAQAKGPLLVVDKFRKEYQRGKE
EVFVAANDISFEVLPGTTHAIVGESGSGKTTLGRAIAMFNTPTSGSISVGGKDITNLSKA
QQRELRQQIQLVYQNPYSSLDPRQTIGATIAEPLRNFTKVSKQDADEKVAHYLELVALDP
ALATRRPRELSGGQRQRVAIARAMILEPELVVFDEAVSALDVTVQAQILRLLDDLQRELG
LTYVFISHDLAVVREISDTVSVMSRGNQVELGKTAEVFNNPQTDFTRRLIDAIPGSRYRG
GELNLGL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgactactcccttgttagagatcaacgatctggttgtctcctatcaaactgctaaaggt
ttggtgcacgctgtcaacaatgtcagcctggaggtgcaccctggccaaatcaccgcgatt
gttggtgagtccggatctggtaagtccaccaccgctcaggccgtgattggtttgctggct
gataatgctgaagtggattctggtcggatttctttcaacggccgttcccttgttggcttg
aacgcacgtgagtggaaaaacgttcgcggtaccaaaattggtttgattccgcaggacccc
aacaactctctgaacccggtgaaaactatcggcgcttcagtgggggagggcttggctatc
cacaagcgtggaactgccgcggagcgcaagaagaaggtcattgagcttctagaacgcgtg
ggtattgataacccagaggtccgctatgaccaatacccgcatgagctctctggtggcatg
aagcagcgcgcgttgatcgcagctgccattgcacttgagccagagctgatcatcgccgat
gagcctacatcggcgctggatgtgaccgtgcagaaaattattctcgatctgctggaagac
atgcagcgtgaattgggcatgggtattttgtttattactcacgatctggccgtggcaggc
gatcgggcggatcaaatcgtcgtcatgcaaaaaggcgaggtgcgcgaaagtggttacgcg
gcttcggtcttgaccgacccccagcatgaatattcgaagaagttgcttgccgacgcgccc
tccctcaccatcggcgagatccccacgcgagttccggccatagatccggaggtagcgcag
gctaaaggcccgctgttggtcgtggataaattccgcaaggaataccaacgcggcaaggag
gaggtatttgtcgcggcaaatgacatttcctttgaggtgctgcctggcaccacgcatgcc
atcgtcggtgaatccggttccggtaaaaccacccttggccgcgcgatcgcgatgttcaat
accccaacctctgggtccatttcagtgggtggcaaggacatcaccaacctgtccaaggca
cagcagcgggaactgcgccagcaaatccagctggtctaccaaaacccgtattcttccctc
gatcctcgccaaaccattggcgccaccatcgcggaaccgctgcgcaatttcaccaaggtg
agcaagcaagacgccgacgaaaaggtggcacactacctggagctggtggcgcttgatccg
gctcttgccacccgtcgcccacgtgagctctctggtggtcagcgccagcgcgtcgccatt
gctcgtgccatgattttggaacctgaattggtggttttcgacgaagccgtatccgcgttg
gatgtgactgtgcaggcacaaatcctgcgcctgctcgacgatctgcaacgagagctaggc
ttgacttacgtgtttatttcccacgacctggctgtggtccgtgaaatctctgacactgtg
tctgtgatgagccgcggcaaccaggtggaacttggaaaaaccgcagaagtatttaacaac
ccgcaaaccgatttcactcgccgactcatcgacgcgatcccaggatcgcgctatcgtggt
ggcgaacttaatcttggactatag

DBGET integrated database retrieval system