KEGG   Corynebacterium glutamicum R: cgR_0055Help
Entry
cgR_0055          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cgt  Corynebacterium glutamicum R
Brite
KEGG Orthology (KO) [BR:cgt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cgt01001]
    cgR_0055
Enzymes [BR:cgt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     cgR_0055
Protein kinases [BR:cgt01001]
 Serine/threonine kinases: Other
  Bacterial family
   cgR_0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH RIO1 Pkinase_fungal Kinase-like Kdo
Motif
Other DBs
NCBI-ProteinID: BAF53016
UniProt: A4Q9X3
LinkDB All DBs
Position
complement(61929..63338)
Genome map
AA seq 469 aa AA seqDB search
MSQEDITGKDRLQELIGADYRLQWIIGHGGMSTVWLADDVVNDREVAIKVLRPEFSDNQE
FLSRFRNEAQAAENIDSEHVVATYDYREVPDPAGHTFCFIVMEFVRGESLADLLEREGSL
PEDLALDVMEQAAHGLSVIHRMNMVHRDIKPGNMLITANGIVKITDFGIAKAAAAVPLTR
TGMVVGTAQYVSPEQAQGKEVTAASDIYSLGVVGYEMMAGRRPFTGDSSVSVAIAHINQA
PPQMPTSISAQTRELIGIALRKDPGRRFPDGNEMALAVSAVRLGKRPPQPRTSAMMAQAE
APSPSESTAMLGRVARPATITQEAAPKRGSGIGIGLFIAALLAVIIGAVIYAGTTGILFN
DTPEETTTPETITETYTPTVEETTSQWVPPTPPTRSTFTEPETTSHRPTTSEESTSAEPT
TEAPTSSRTVPQIPTSTPRTSASVPVETNAPADDLIDAVNGLLDVGGAQ
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagaagacatcactggaaaagatcgactccaagaactcatcggcgctgattat
cgtctgcagtggatcatcggacacggtggcatgtccaccgtgtggctcgcagatgatgtg
gtcaatgatcgcgaagtagccatcaaggtactgcgcccggaattttccgacaaccaggag
ttcttgagccgtttccgcaatgaagcgcaagcggctgagaatatcgattctgaacacgtg
gtggccacctatgactaccgtgaggttccagaccctgctgggcatactttctgcttcatc
gtcatggaatttgtccgcggtgaatcgcttgcggatcttctagagcgcgaaggcagcctg
cctgaagatttggctcttgatgtgatggagcaggccgcgcatggtttgtcggtgattcac
cggatgaacatggtgcaccgcgatatcaagccgggcaacatgctgatcacagccaatggc
attgtgaagatcacggactttggtatcgctaaggctgccgctgctgtgcctttgacccgc
accggcatggtggtgggtactgctcaatatgtttcacctgagcaagcccagggcaaggaa
gtcaccgcggcttctgatatttattctctcggtgtggtcggctatgagatgatggctggc
cgccgcccgttcactggagattcttcggtgtctgtggcgatcgcgcacatcaaccaagct
ccgccgcagatgcccaccagcatttcggcacagacacgtgaactgattggcattgcgctg
cgcaaggatccgggtcgccgtttccctgatggaaatgaaatggcgctagctgtttctgct
gtgcgccttggcaagcgcccgcctcaaccgcgcacgagcgcgatgatggcgcaggcggag
gcgccgtcgccaagcgaatcaacggcgatgctgggcagggtggcccggcctgcaacaatc
acccaagaagcggccccgaaacgcggttccggcattggcattgggctgttcatcgcagct
ttgctggccgtgattattggcgcggtgatctatgcgggcaccaccggaattttgttcaac
gacactccggaagaaaccaccacacctgaaaccattacggaaacctacaccccaaccgtg
gaggaaaccacctctcagtgggtaccgccaacgcctccaactcggtcaacattcaccgaa
cctgaaacaacttcacaccgtccgacgacaagtgaagagagcacatccgcggaaccaacc
acggaagctccaacaagtagccgaactgtgcctcaaatccctacctctacacctaggacg
agtgctagcgttccagttgagactaatgcaccggctgatgatttaatcgacgccgtaaat
ggcctattggatgtaggaggagcgcagtga

DBGET integrated database retrieval system