KEGG   Corynebacterium glutamicum R: cgR_0581Help
Entry
cgR_0581          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K09684  PucR family transcriptional regulator, purine catabolism regulatory protein
Organism
cgt  Corynebacterium glutamicum R
Brite
KEGG Orthology (KO) [BR:cgt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cgt03000]
    cgR_0581
Transcription factors [BR:cgt03000]
 Prokaryotic Type
  Other transcription factors
   Others
    cgR_0581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PucR HTH_30 HTH_8 HTH_23 HTH_17 Robl_LC7
Motif
Other DBs
NCBI-ProteinID: BAF53549
UniProt: A4QBF2
LinkDB All DBs
Position
complement(640366..641880)
Genome map
AA seq 504 aa AA seqDB search
METPTQDMDVRWLYTQSQLKLREILPTNKTFDVIQISELVDPTDFISPNSVVLSVGIAFA
ETPDGLRDWAHRLADAGVIAIGFGSGLTFPQVPQALIDASLHLGLGLFEVPREIPFISIT
SSVRDEQTRRAGRLQQELLLEQERLNSIAISGGIEALCRAAADYLGGAVTIVDSDGRVAC
SITTDDLDALPQAVSRLNGSSQALTDATNFGFIHRMTRYGDRHHVLSVLMPTRPSEQHRA
LIRHCAGLADILLQRPEAMRDREIEVRSLAMSLLLGRSDDLATIHRVFADITDASGNIRP
ILITGNTPQSVRKALSSVATALYKQERALAHLRLAESTELLFLRGSRSVHNIVQLFGTAA
SGVRLCIGLPTRVENIDKKLIRELTATAKTLQLGTHAEPRDGTLLWLQNPELRKILKIRS
RDTYDRLLDHDRTNNTELAPTLVSFTQHGGHIGDTAKELGIHRHTVRTRMIRIEEICEID
LNDPLTRAELLLVIATKEGDVEKH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccccaacccaagacatggatgtccgctggttatacacccaaagccagctcaaa
ctccgcgaaattctccccacaaacaaaaccttcgatgtcatccaaatcagcgaactcgtt
gaccccaccgacttcatcagccccaacagcgtggtcttatccgttggcatcgccttcgca
gaaacacccgacgggcttcgcgattgggcacaccgactcgccgacgcaggggtcatcgcg
atcgggttcggctccggcctcaccttcccacaggttccgcaggcgcttatcgacgcctcc
ctccaccttggcctcggcctctttgaagtcccccgtgaaattccattcatctcgatcacc
tccagtgtgcgtgatgaacaaacccgccgtgccggccgcctgcaacaagaactcctcctg
gaacaggaacgacttaactccatcgccatctccggtggcatcgaagccctgtgccgtgct
gccgccgactatttgggtggtgcagtaaccatcgtggacagcgacggccgcgtggcttgc
tctattaccaccgacgacctagacgcactcccccaagctgtctcgcgccttaacggatcc
agtcaagcactcacggatgccaccaactttggattcatccaccgcatgaccaggtacggc
gaccgccaccacgtactctcagtccttatgcccacccgccccagcgaacaacaccgcgca
ctgatcagacactgcgcaggccttgccgatattttgcttcaacgccccgaagccatgcgc
gaccgagaaatcgaagtgcgctcacttgccatgtcactacttctgggtcgaagcgacgac
ctagccaccattcaccgcgtgttcgctgacatcactgatgcttccggaaatatccgcccc
atcctcatcaccggcaacacaccccaatcagtacgaaaagcactctccagtgtcgccacc
gcactgtacaaacaggaacgagcactagctcatctacgcctcgccgaatccaccgaactc
ctcttccttcgcggaagccgcagcgtgcacaacatcgtgcaactttttggtactgcggca
agcggagttcgcctctgcattggtctgcccacccgagtggaaaacatcgataagaaactt
atccgcgaactcaccgccaccgcaaaaaccctacaacttggaacccacgccgaaccccgt
gacggcaccttgctgtggctccaaaaccccgagctgcgcaaaatcctcaagatccgatcc
cgcgacacctacgaccgtctcctcgaccacgaccgcaccaacaacaccgagctcgccccc
accttggtgtcttttactcagcacggcggacatataggcgacaccgccaaagaactaggc
atccaccgccacaccgtgcgcacccgcatgatccgcattgaagagatctgcgaaatcgac
ctcaatgatccactgaccagagcggagctgctcttagtgatcgcaacgaaggagggagac
gtcgaaaagcattaa

DBGET integrated database retrieval system