KEGG   Corynebacterium glutamicum R: cgR_1739Help
Entry
cgR_1739          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cgt  Corynebacterium glutamicum R
Pathway
cgt00010  Glycolysis / Gluconeogenesis
cgt00520  Amino sugar and nucleotide sugar metabolism
cgt01100  Metabolic pathways
cgt01110  Biosynthesis of secondary metabolites
cgt01120  Microbial metabolism in diverse environments
cgt01130  Biosynthesis of antibiotics
cgt01200  Carbon metabolism
Module
cgt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cgR_1739
   00520 Amino sugar and nucleotide sugar metabolism
    cgR_1739
Enzymes [BR:cgt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     cgR_1739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: BAF54733
UniProt: A4QER7
LinkDB All DBs
Position
1929271..1930503
Genome map
AA seq 410 aa AA seqDB search
MARGGVQHPGDHIDHSTCYDLAVDRRSDRDGVLGQAIKEVDGAVNGVDDPGNSAYRRRPR
PFLAYQPVFRPKFLQPIGDKIFSQSIYYRHRIDCRTFGVGVVPQIGEFSTFIPDTCSGKR
GSFRGDGTQLIKRLLFHKTIIVVFLENCLPKAEVICTLGRMTETGFGIDIGGSGIKGARV
NLKTGEFIDERIKIATPKPATPEAVAEVVAEIISQAEWEGPVGITLPSVVRGQIALSAAN
IDKSWIGTDVHELFDRHLNGREITVLNDADAAGIAEATFGNAAAREGAVILLTLGTGIGS
AFLVDGQLFPNTELGHMIVDGEEAEHLAAAAVKENEDLSWKKWAKRLNKVLSEYEKLFSP
SVFIIGGGISRKHEKWLPLLELDTDIVPAELRNRAGIVGAAMAVNQHLTP
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgcggcggtgtacagcaccccggtgaccacattgatcacagcacctgctacgac
ctcgccgtcgatcgccgcagcgatcgagacggcgtattggggcaggccataaaggaagtt
gacggtgccgtcaatggggtcgacgatccaggtaactccgcttatcgacgccgtccccgt
cccttcctcgcctatcagcccgtctttaggccgaagttcctgcaacctattggcgataaa
atcttcagccaaagtatctactatcgtcaccggatcgactgtcgaacttttggtgttggt
gtagtcccacaaattggtgagttcagcacgtttatccctgatacgtgtagcggtaagcgt
ggcagtttccgcggcgatggcacgcaactcattaaacgattgttgttccataagaccatc
atcgttgtttttttagaaaattgcctgccaaaagccgaagtaatttgtacacttgggcgc
atgactgagactggatttggaattgatatcggtggctccggcatcaaaggcgcccgcgtt
aaccttaagaccggtgagtttattgatgaacgcataaaaatcgccacccctaagccagca
accccagaggctgtcgccgaagtagtcgcagagattatttctcaagccgaatgggagggt
ccggtcggaattaccctgccgtctgtcgttcgcgggcagatcgcgctatccgcagccaac
attgacaagtcctggatcggcaccgatgtgcacgaactttttgaccgccacctaaatggc
cgagagatcaccgttctcaatgacgcagacgccgccggcatcgccgaagcaacctttggc
aacgctgccgcacgcgaaggcgcagtcatcctgctgacccttggtacaggtattggatcc
gcattccttgtggatggccaactgttccccaacacagaactcggtcacatgatcgttgac
ggcgaggaagcagaacaccttgcagcagcagccgtcaaagaaaacgaagatctgtcatgg
aagaaatgggcgaagcgcctgaacaaggtgctgagcgaatacgagaaacttttctcccca
tccgtcttcatcatcggtggcggaatttccagaaagcacgaaaagtggcttccattgctg
gagctagacactgacattgtcccagctgagctgcgcaatcgagccggaatcgtaggagct
gccatggcagtaaaccaacacctcaccccataa

DBGET integrated database retrieval system