KEGG   Corynebacterium glutamicum K051: WA5_0075Help
Entry
WA5_0075          CDS       T02508                                 

Gene name
CodA
Definition
(GenBank) cytosine deaminase or related metal-dependent hydrolase
  KO
K01485  cytosine/creatinine deaminase [EC:3.5.4.1 3.5.4.21]
Organism
cgu  Corynebacterium glutamicum K051
Pathway
cgu00240  Pyrimidine metabolism
cgu00330  Arginine and proline metabolism
cgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    WA5_0075 (CodA)
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    WA5_0075 (CodA)
Enzymes [BR:cgu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.1  cytosine deaminase
     WA5_0075 (CodA)
    3.5.4.21  creatinine deaminase
     WA5_0075 (CodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_3 Amidohydro_1 DUF2332
Motif
Other DBs
NCBI-ProteinID: CCH23296
LinkDB All DBs
Position
complement(83688..84935)
Genome map
AA seq 415 aa AA seqDB search
MRITNAQVKNYAELVDITIEGEKISSITPSSIRSEEDHRADDYDAAGRLVAPQFAEAHIH
LDYANTAGIPRENSSGTLFEAIEIWADRKTQGFHIKEDIKAKALQAARRAAEHGVGFIRT
HVDVTDPTFAGFEAIAELRDEVREWCDIQIVAFPQNGIYAYEGGQKLISDAMSAGADVVG
GIPHLEPTRDDGVESVKWLFDLAEKHSAPIDIHTDEIDDPHSRFVEVLAAEAAKRDMGAQ
TVVSHSVAMAYYSPGYMARLLPKLAASKVRFAVCPNENLHLQGLGFQGPVPRGVAPVKQL
TEWGIPVSFCQDSLNDPFYPMGDGDLLRILDSGLHVSHMLTASHLKNALSFITTNPAGNL
GLDNYDIAENSPANLLVLDASSEKEAVQRKASVLLSIHRGKKVLSREPEQVDWNI
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcattacaaacgcccaggttaagaactacgcagagttagttgatatcaccatagag
ggtgaaaaaatttcctcgattaccccctcttcaattcgatcagaagaagatcaccgcgcg
gacgattacgatgccgcaggaagactggtcgcaccccagttcgccgaagcacacatccac
cttgactacgcaaacaccgctggaatccctcgcgaaaactcttccggcacactttttgaa
gccatcgaaatctgggccgaccgcaagacccaaggcttccacatcaaagaagacattaaa
gcgaaggccctccaggcagcccgtcgggcagcagaacacggcgttggtttcatccgcact
cacgtagatgtcaccgatcccacgtttgctggattcgaagcaattgcggagctgcgcgat
gaagtccgcgagtggtgcgatatccagattgtcgccttcccgcaaaatggcatttacgcc
tacgaaggtggccagaagctaatctcagatgcaatgtctgcaggtgcagatgtcgttggt
ggcatcccacaccttgaacccacccgagacgatggcgtcgagtcggtgaaatggctgttc
gaccttgcagagaagcactcagcccccatcgatatccacactgatgaaattgacgatcca
cattcccgatttgtcgaagtcctcgccgcagaagccgcaaaacgtgacatgggcgcacaa
accgtggtgtctcattctgtggcgatggcctattactcacctggctacatggcgcgactt
ttacccaagctcgcagcatcaaaggttcgttttgcagtatgccccaatgaaaacctccat
ctgcaaggacttggtttccaaggacccgtcccccgaggtgttgcaccggtaaagcaactt
accgaatggggaattccagtaagtttttgccaggactcactcaatgaccccttctacccc
atgggcgatggagatctactccgcattctcgattctggattacacgtgtcccacatgctc
acagccagccacttgaagaatgcactatcgttcatcaccaccaatccagccggaaaccta
ggcctggacaattacgacattgcagaaaactccccggcgaacctgctggttcttgatgcg
agcagcgagaaggaagctgtacagagaaaagcttccgtacttttgagcatccaccgcggc
aaaaaggtgctctccagggagcccgaacaggtggactggaacatctaa

DBGET integrated database retrieval system