KEGG   Corynebacterium glaucum: CGLAU_04775Help
Entry
CGLAU_04775       CDS       T05058                                 

Definition
(GenBank) Putative DNA ligase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cgv  Corynebacterium glaucum
Pathway
cgv03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cgv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CGLAU_04775
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cgv03400]
    CGLAU_04775
Enzymes [BR:cgv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CGLAU_04775
DNA repair and recombination proteins [BR:cgv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CGLAU_04775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AQQ14929
UniProt: A0A1Q2HVQ4
LinkDB All DBs
Position
944040..946424
Genome map
AA seq 794 aa AA seqDB search
MAQQSTKVRVDGHDLKVSSLDKVLYPATGTTKADVMRYYLEVADVMVPQIARRPVTRKRW
PDGVDKQSFFRKDLEDSAPSWITTGEIEHKTSTNTYPLVDGPAVLAWFAQVAALELHTPQ
WRFGKGDSKQNPDRLVLDLDPGEGVTLAETAEIALACNEVLDGMGLVSVPVTSGSKGIHI
YAGLDGETDAAGVSQVAKALAQALEEEYPERVTAVMRKTERAGKIFLDWSQNNGNKTTVS
PYSLRGRERPTVAAPRTWEEIAEPGLKHLVFEEVIERVQEGLDPIAALGGGETAAPGGDR
LTTYRSMRDATKTGEPVPEAAPRPRDGVPIFVIGEHHARRLHWDFRLEHDGVLVSWAVPK
GPPLDPKENRLAVQTEDHPIEYAWFEGTIPKGQYGAGDVKIWDIGTCEIEKWRDDEIIAV
LFGRDDGGLGGVPRRFALIRTDAEENHWLLKFMKRQPDEATPAPGELEAPEPAPAEPAPA
DTAPADFAPATPPKPMLATAGTKADIDLAVKDGATFAFEMKWDGYRIIADTRAGTTRLIS
RNGKDYTSLFPHIEEFEQLLVDATVDGELIALDEDGRPSFSALHGADKHGSTEGVELRYM
AFDLLRLGERDLTGEPYTQRHKALEALGESDHIVVPPAYTGSFKSAWRVAEEMGLEGVVA
KQTSSVYEPGERSRAWLKIKRALHQAVVVVGVREGKSLLVAVPDEDGELAYAGRVGTGFS
AGQFAEIEKKLRRSKRKTPPVDVPKSDTEGVFWVTPKYVAEVALAGATGGRKVRQASWRG
WREDLDPSEVRWEV
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcagcaaagcacaaaagtgcgcgttgacgggcacgacctaaaggtcagcagcctc
gacaaggtgctctacccggccacaggcaccaccaaggccgatgtcatgcgctactatctc
gaggtcgccgatgtcatggtgccccagatcgcgcgccggccggtgactcgaaaacgctgg
ccagatggcgtcgataagcaaagcttcttccgaaaagacctggaggattctgctccgagc
tggatcaccaccggggagatcgagcacaagacctcgacgaacacatatccgcttgtcgac
ggcccagccgtgcttgcttggttcgcccaagttgccgctcttgagctgcacaccccgcag
tggcgcttcgggaagggcgattcgaagcagaacccggatcggctggtgctggatcttgac
ccgggcgagggcgtgacgctcgcggagactgccgagatcgcgctcgcgtgcaacgaggtg
ctcgacggcatgggtctggtcagcgtgccggtgacgtccgggtcgaaaggcattcacatc
tacgcggggttggatggggagaccgatgcggcaggcgtgagccaggtggcgaaggcgctt
gcgcaggcgctggaggaggaatacccggagcgcgtgacggccgtgatgcgcaagacggag
cgcgccgggaagatcttcctcgactggagccagaacaacggcaacaagacgacggtgagt
ccgtactcgttgcgcggccgggagcggccgaccgtggcggcgccgcggacgtgggaagag
atcgcggagccggggctgaagcacctcgtgttcgaggaggtgattgagcgcgttcaggag
ggtctagatccgattgctgcgctcggaggtggggagacggctgctcccgggggcgaccgc
ctgaccacctatcgctccatgcgagacgcgacgaagaccggcgagcctgtgcccgaggcc
gcgccgcgtccacgcgacggggtgccgatcttcgtgatcggcgagcaccacgcgcgccgc
ctgcactgggatttccgccttgagcacgacggggtcctcgtctcctgggccgtgccaaag
ggccctccgctggatccgaaagagaaccgcctcgcggtgcagaccgaggaccacccgatc
gagtacgcctggttcgaaggcacgattccgaagggccagtacggcgcgggggatgtgaag
atctgggacatcggcacctgcgagatcgagaagtggcgcgacgacgagatcatcgccgtg
ctcttcggccgcgacgacggcggcctcggcggggtcccgcgccgcttcgcgctgattcgc
accgatgcggaggaaaaccactggctgctgaagttcatgaagcgccagcctgacgaggcc
acgccagcgccgggcgagcttgaggcgccggagcccgcaccggctgagcccgcgcccgcc
gacacggcacccgccgacttcgcgccggccacgccaccgaaacccatgctcgccaccgcc
ggcaccaaagccgatatcgacctggccgtcaaagacggcgccaccttcgcgttcgaaatg
aagtgggacggctaccgcatcatcgccgacacccgcgccggcaccacccgcctgatcagc
cgaaacggcaaggactacacctcgctcttcccccacatcgaggagttcgagcaattgctt
gtcgacgccaccgtcgacggcgagctcatcgccctcgacgaggacggacgccccagtttc
tctgcgctgcacggcgcggataagcacggcagtaccgagggagtcgagctgcgctacatg
gcctttgatcttctgcgtctcggggagcgcgacctcaccggtgagccgtacacgcagcgt
cacaaagctttggaagcgctgggggagagcgaccacatcgtggtgcctcccgcctatacg
ggcagcttcaaatctgcttggcgggtggctgaggaaatggggttggaaggggtcgtcgca
aagcaaacaagctctgtgtacgagcctggggaacgaagccgcgcgtggctgaagatcaag
cgggcgctgcaccaagcggtggtcgttgttggggtgcgtgagggcaagtcgctgctggtg
gcggtgccggatgaggacggcgagctggcgtacgccgggcgggtgggcaccgggttttct
gccgggcagttcgccgagattgagaagaagctgcggcgcagcaagcgaaaaacgcccccg
gtggacgtgccgaagtctgataccgagggcgtgttctgggtgacgccgaagtacgttgcc
gaggtcgcgcttgcgggcgcgactgggggcaggaaggtacgccaggcgtcgtggcgcggg
tggcgcgaggacctcgaccccagcgaggtgcgctgggaggtctag

DBGET integrated database retrieval system