KEGG   Candidatus Campbellbacteria bacterium GW2011_OD1_34_28: UR58_C0001G0010Help
Entry
UR58_C0001G0010   CDS       T04488                                 

Definition
(GenBank) manganese/iron superoxide dismutase-like protein, superoxide dismutase, Fe-Mn family
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cgw  Candidatus Campbellbacteria bacterium GW2011_OD1_34_28
Brite
Enzymes [BR:cgw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     UR58_C0001G0010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AKM83727
LinkDB All DBs
Position
complement(11674..12282)
Genome map
AA seq 202 aa AA seqDB search
MQKYEEKKFNLPKMEGISEKQIEEHLKLYSGYVKHTNLIREKIAELSEDKDSNAYLISEL
RRRFNFEFNGMRMHEYYFEQFEGGAKDLNEESNLAKVLAEKYGSLEKSIEHFAEVGKSRG
IGWAVLVYDTQAKTPHIVWVGDHELGQLGGLPIIAVMDMWEHAFMVDYVPSEKGKYIDAF
LKNINSEVLEKRYNDLGVRSKE
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatacgaagaaaaaaaatttaatttaccaaagatggaaggtatttctgaaaag
caaatagaagaacatttaaagctttattcgggctatgttaaacacacaaatttgatcaga
gaaaagatcgcagaattgtccgaggacaaagacagcaatgcttatttgatttctgaattg
agaagaagatttaattttgaattcaacggaatgagaatgcatgaatattattttgagcag
ttcgaaggcggtgcaaaagatttaaatgaagaaagtaatttggcaaaagttttggcagaa
aaatatggaagtttggaaaaatcaattgaacattttgcagaggttggaaaaagtagggga
attggttgggctgtgttggtatatgacacacaagcaaaaactcctcatattgtttgggtg
ggagaccatgaattgggtcaattgggaggacttccgataatcgcggtgatggatatgtgg
gaacatgcatttatggtggattatgtgccaagtgaaaaaggaaaatatattgatgcgttt
ttaaaaaatataaacagtgaggttttggaaaagagatataatgatttaggagtaaggagt
aaggagtaa

DBGET integrated database retrieval system