KEGG   Candidatus Campbellbacteria bacterium GW2011_OD1_34_28: UR58_C0001G0513Help
Entry
UR58_C0001G0513   CDS       T04488                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F, alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cgw  Candidatus Campbellbacteria bacterium GW2011_OD1_34_28
Brite
KEGG Orthology (KO) [BR:cgw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    UR58_C0001G0513
Enzymes [BR:cgw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     UR58_C0001G0513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 GIDA Pyr_redox HI0933_like FAD_oxidored FAD_binding_2 DAO Thi4 NAD_binding_8 NAD_binding_7 FAD_binding_3 Lycopene_cycl K_oxygenase TrkA_N
Motif
Other DBs
NCBI-ProteinID: AKM84230
LinkDB All DBs
Position
complement(536837..537763)
Genome map
AA seq 308 aa AA seqDB search
MIYELAIIGGGPAGISAGIYAARKKLKTVLIADSFGGQSIVSDDIQNWVGTKSISGQELS
KNLESHLKEYAGDIVDIKEGEKVELISGNKVDGFEIKTKNNLYKAKTVLVTTGSHRRRLQ
AKNADVLEHRGITYCATCDGPLYTGRDVMVIGGGNAGFETASQLLAYAKSVTLLHKNGKF
KADEITVKKVSSHPNFKLISNAETKEILGEKFVTGLRYIDIHTGEEKEVSTNGIFVEIGA
EPTTGFVSELVKLNDYKSIVVDHQTQRTSAEGVWAAGDCTDGLYHQNNIASGDAIKALED
IYIYIRTK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgatatacgaactggcaatcattggcggaggtcccgcaggaatcagcgcaggaatatac
gctgcaagaaaaaaattaaaaactgttttaattgcagactcttttggcggacaaagtatt
gtgtccgatgatattcaaaactgggttggaacaaaatctatttcgggacaagagctatca
aaaaatctggaaagtcacttaaaagaatatgctggcgatattgttgatattaaagaaggt
gaaaaagtagagctgataagtggaaataaagttgatggctttgaaataaaaacaaaaaat
aatttatacaaagcaaagacagtcttggtaacaacaggaagtcaccgaagaagattacaa
gcaaaaaatgctgatgtcttggaacatcgcggaattacttactgtgctacctgtgatggc
cctctatacacaggaagagatgtaatggttattggtggcggtaatgcaggatttgaaacc
gcttcccaacttttagcatatgccaagagcgtcactctgctacacaaaaatggaaaattt
aaagcagatgaaataaccgtcaaaaaagtttcctcacatccaaatttcaaactgatatca
aatgccgagacaaaagaaatattaggagaaaaatttgtcactggtttgagatatattgat
attcacacaggcgaagaaaaagaagtttctacaaatggaatctttgtagaaattggtgca
gaaccaacaacaggatttgtttctgaattggtcaaactgaacgactacaaatctatcgtt
gttgatcatcaaacacaaagaacctctgcagagggtgtttgggcagctggagattgtacc
gacggtttatatcatcaaaacaatattgcttcgggagatgctataaaagctttggaagat
atttatatttatataagaacaaaataa

DBGET integrated database retrieval system