KEGG   Corynebacterium glutamicum B253: SB89_00225Help
Entry
SB89_00225        CDS       T03668                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cgx  Corynebacterium glutamicum B253
Brite
KEGG Orthology (KO) [BR:cgx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cgx01001]
    SB89_00225
Enzymes [BR:cgx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SB89_00225
Protein kinases [BR:cgx01001]
 Serine/threonine kinases: Other
  Bacterial family
   SB89_00225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH RIO1 Pkinase_fungal Kdo Kinase-like
Motif
Other DBs
NCBI-ProteinID: AJE66122
LinkDB All DBs
Position
complement(40647..42056)
Genome map
AA seq 469 aa AA seqDB search
MSQEDITGKDRLQELIGADYRLQWIIGHGGMSTVWFADDVVNDREVAIKVLRPEFSDNQE
FLNRFRNEAQAAENIDSEHVVATYDYREVPDPAGHTFCFIVMEFVRGESLADLLEREGSL
PEDLALDVMEQAAHGLSVIHRMNMVHRDIKPGNMLITANGIVKITDFGIAKAAAAVPLTR
TGMVVGTAQYVSPEQAQGKEVTAASDIYSLGVVGYEMMAGRRPFTGDSSVSVAIAHINQA
PPQMPTSISAQTRELIGIALRKDPGRRFPDGNEMALAVSAVRLGKRPPQPRTSAMMAQAE
APSPSESTAMLGRVARPATITQEAAPKRGSGIGIGLFIAALLAVIIGAVIYAGTTGILFN
DTPEETTTPETITETYTPTVEETTSQWVPPTPPTRSTFTEPETTSHRPTTSEESTSEEPT
TEAPTSSRTVPQIPTSTPRTSASVPVETNAPADDLIDAVNGLLDVGGAQ
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagaagacatcactggaaaagatcgactccaagaactcatcggcgctgattat
cgtctgcagtggatcatcggacacggtggcatgtccaccgtgtggttcgcagatgatgtg
gtcaatgatcgcgaagtagccatcaaggtactgcgcccggaattttccgacaaccaggag
ttcttgaaccgtttccgcaatgaagcgcaagcggctgagaatatcgattctgaacacgtg
gtggccacctatgactaccgtgaggttccagaccctgctgggcatactttctgcttcatc
gtcatggaatttgtccgcggtgaatcgcttgcggatcttctagagcgcgaaggcagcctg
ccggaagatttggctcttgatgtgatggagcaggccgcgcatggtttgtcggtgattcac
cggatgaacatggtgcaccgcgatatcaagccgggcaacatgctgatcacagccaatggc
attgtgaagatcacggactttggtatcgctaaggctgccgctgctgtgcctttgacccgc
accggcatggtggtgggtactgctcaatatgtttcacctgagcaagcccagggcaaggaa
gtcaccgcggcttctgatatttattctctcggtgtggtcggctatgagatgatggctggc
cgccgcccgttcactggagattcttcggtgtctgtggcgatcgcgcacatcaaccaagct
ccgccgcagatgcccaccagcatttcggcacagactcgcgagttgattggcattgcgttg
cgcaaggatccgggtcgccgtttccctgatggaaatgaaatggcgctagctgtttctgct
gtgcgccttggcaagcgcccgcctcaaccgcgcacgagcgcgatgatggcgcaggcggag
gcgccgtcgccaagcgaatcaacggcgatgctgggcagggtggcccggcctgcaacaatc
acccaagaagcggccccgaaacgcggttccggcattggcattggtctgttcatcgcagct
ttgctggccgtgattattggcgcggtgatctatgcgggcaccaccggaattttgttcaac
gacactccggaagaaaccaccacacctgaaaccattacggaaacctacaccccaaccgtg
gaggaaaccacctctcagtgggtaccgccaacgcctccaactcggtcaacattcaccgaa
cctgaaacaacttcacaccgtccgacgacaagtgaagagagcacatccgaggaaccaacc
acggaagctccaacaagtagccgaactgtgcctcaaatccctacctctacacctaggacg
agtgctagcgttccagttgagactaatgcaccggctgatgatttaatcgacgccgtaaat
ggcctattggatgtaggaggagcgcagtga

DBGET integrated database retrieval system