KEGG   Corynebacterium glutamicum B253: SB89_02730Help
Entry
SB89_02730        CDS       T03668                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cgx  Corynebacterium glutamicum B253
Brite
Translation factors [BR:cgx03012]
 Eukaryotic Type
  Elongation factors
   SB89_02730
 Prokaryotic Type
   SB89_02730
Mitochondrial biogenesis [BR:cgx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SB89_02730
Exosome [BR:cgx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SB89_02730
  Exosomal proteins of breast cancer cells
   SB89_02730
  Exosomal proteins of colorectal cancer cells
   SB89_02730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AJE66544
LinkDB All DBs
Position
583956..585146
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPELNEAFAFDSIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVEDEEIIELVEMEVRELLAEQDYDEDAPIVHISALKAL
EGDEKWGKQILELMQACDDNIPDPVRETDKPFLMPIEDIFTITGRGTVVTGRVERGTLNV
NDDVDIIGIKEKSTSTTVTGIEMFRKLLDSAEAGDNCGLLLRGIKREDVERGQVIVKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgaagttcgagcgtaccaagccccacgtaaacatcggcaccatcggtcac
gttgaccacggtaagaccaccaccaccgcggctatcaccaaggttctggctgacgcttac
cctgagctcaacgaggctttcgccttcgactccatcgataaggctcctgaggagaaggag
cgtggcatcacgatcaacatctcccacgttgagtaccagaccgaaaagcgccactacgca
cacgttgacgctccaggccacgccgactacatcaagaacatgattaccggcgctgctcag
atggacggcgcaatcctcgttgttgctgctaccgacggcccaatgcctcagacccgtgag
cacgttcttcttgctcgccaggttggcgttccttacatcctcgttgctcttaacaagtgc
gacatggttgaggatgaggaaatcatcgagctcgtcgagatggaagttcgtgaacttctt
gctgagcaggactacgacgaagatgctccaattgtccacatctccgctctgaaggctctt
gagggcgacgagaagtggggcaagcagatccttgagctcatgcaggcttgcgatgacaac
atccctgacccagttcgtgagaccgacaagccattcctcatgcctatcgaggacatcttc
accatcaccggtcgtggcaccgttgttaccggtcgtgttgagcgcggtaccctgaacgtg
aacgatgatgttgacatcatcggcatcaaggagaagtccacctccaccaccgttaccggt
atcgagatgttccgtaagcttcttgactccgctgaggctggcgacaactgtggtctgctt
ctccgtggtatcaagcgcgaagatgttgagcgtggccaggttatcgttaagccaggcgct
tacacccctcacaccgagttcgagggctctgtctacgttctgtccaaggatgaaggtggc
cgccacaccccattcttcgacaactaccgtcctcagttctacttccgcaccaccgacgtt
accggtgttgtgaagcttccagagggcaccgagatggttatgcctggcgacaacgtcgac
atgtccgtcaccctgatccagcctgtcgctatggacgagggcctgcgtttcgctatccgc
gaaggctcccgcaccgttggcgctggtcgtgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system