KEGG   Corynebacterium glutamicum B253: SB89_08675Help
Entry
SB89_08675        CDS       T03668                                 

Definition
(GenBank) inositol-phosphate phosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
cgx  Corynebacterium glutamicum B253
Pathway
cgx00521  Streptomycin biosynthesis
cgx00562  Inositol phosphate metabolism
cgx01100  Metabolic pathways
cgx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cgx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SB89_08675
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SB89_08675
Enzymes [BR:cgx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     SB89_08675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P FBPase
Motif
Other DBs
NCBI-ProteinID: AJE67606
LinkDB All DBs
Position
complement(1851208..1852050)
Genome map
AA seq 280 aa AA seqDB search
MEQQSFNELRAIAAETATLTAARIRDKRAELTNLWDYTNTKSSTVDPVTIVDTLAEDFIA
NRLQELRPKDGLIGEEGTGTASISGVTWIVDPIDGTVNFLYDLPQYAVSIAAAIDGEVVA
GAVINVVTGVLYTAARHEGATKYLPERDEIVPLKASAATVVSESLVATGFSYSALRRSLQ
ADLLTKILPTVRDIRRMGSAALDLCHLADGQVDIYYEHGLNCWDFAAGSLIASEAGAFVR
APGLSIPGSSGEICFGAAPGVFDEANAHFDVVGAFKALDR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacaatcgtttaatgagttgcgtgccatcgccgcggaaactgccacgcttacc
gctgcacgtatcagggataagcgtgctgaactcaccaatttgtgggactacaccaacacc
aaaagttcgacagtcgatccggtgacgatagtagatactttggctgaagattttatcgcc
aataggttgcaggaacttcggcctaaagacgggctgataggcgaggaagggacggggacg
gcgtcgataagcggagttacctggatcgtcgaccccattgacggcaccgtcaacttcctt
tatgacctgccccaatacgccgtctcgatcgctgcggcgatcgacggcgaggtcgtggca
ggtgctgtgatcaatgtggtcaccggggtgctgtacaccgccgcgcgccacgaaggtgcc
accaaatatctgcccgagcgcgatgaaatcgtgccgctcaaggcctcagcagccaccgtg
gtcagtgagtcgttggttgctacggggttcagctattccgctttacgacgctccctccaa
gccgatttattaacaaaaatcttgcctactgtgcgcgacattcgccgcatgggaagcgcc
gctttggacctgtgccacctcgctgatggacaagtagatatttactacgaacatggcctg
aactgctgggacttcgcagccggcagcctcattgcgtctgaagcgggcgcctttgtgcgg
gccccagggctctccattccaggctcctctggagagatttgcttcggcgctgcccccgga
gttttcgacgaggccaacgcccattttgatgtagtcggcgcatttaaggctttagaccgt
taa

DBGET integrated database retrieval system