KEGG   Corynebacterium glyciniphilum: CGLY_00435Help
Entry
CGLY_00435        CDS       T03073                                 

Gene name
pknA
Definition
(GenBank) Serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cgy  Corynebacterium glyciniphilum
Brite
KEGG Orthology (KO) [BR:cgy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cgy01001]
    CGLY_00435 (pknA)
Enzymes [BR:cgy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CGLY_00435 (pknA)
Protein kinases [BR:cgy01001]
 Serine/threonine kinases: Other
  Bacterial family
   CGLY_00435 (pknA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH DUF4307 Kinase-like Kdo Pkinase_fungal Seadorna_VP7 RIO1 PLDc_N
Motif
Other DBs
NCBI-ProteinID: AHW62535
UniProt: X5E4Y2
LinkDB All DBs
Position
complement(86207..87781)
Genome map
AA seq 524 aa AA seqDB search
MTGPDDSDNPSDPDGTRIFSTPEEHSGPVDPEHMTPRDRAAADRLQRVLDTHYDSAAGRR
FEVSRIIGRGGMSTVWLAYDTIGERDVAVKVLKPELTDDAEFRDRFRQEAEAAETIQSEN
VVRTFDYGEQADVDGSGIAYCFIVMEYVQGESLADILGRQRTLPEVMVLDLIAQAAVGLQ
AIHERQLIHRDIKPGNLMVTADGVVKITDFGIAKAASAVPLTRTGMVVGTAQYVSPEQAQ
GLSIRPSSDVYSLGVVGYEVLVGERPFSGDSTVSVALKHINEPAPELPENISAPMRQLIA
ICLRKDPARRYPDGAALAAATVPVRDGEMPPDPASGVAPVVAAATAGQAPTGQGRLGEVT
DEANMGPAPRTRSNRGWIWALGIGLVALLGVLVWFLTQGDDESAVPPTETTTVTSEVTEE
QTVVPEPIETEDPVETPTDDTTPTDTTPTEGPTDGPTDTTNPSQPTQPTVPEPEVPTEEP
TNPGNPDTSDQASQEQPDPSGNAGTTGDGDSGDEESGWSVMGRL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggccccgacgattccgacaaccccagtgaccccgacggcacccgtatcttcagc
acccccgaagagcattccggccccgtggaccccgaacacatgaccccacgggaccgggcg
gccgccgaccgtctccaacgcgtcctcgacacccactacgactccgccgcaggacgacgg
ttcgaggtgtcccgcatcatcggccgtggcggcatgtccaccgtctggctggcgtacgac
accatcggcgagcgggacgtggccgtcaaggtgctcaaacccgaactcaccgatgacgcg
gagttccgcgaccgcttccggcaggaagccgaagccgccgaaaccatccagtccgagaac
gtggtgcgcaccttcgactacggcgagcaggccgacgtcgacggcagcggcatcgcctac
tgcttcatcgtgatggagtacgtgcagggtgagtcgctggcggacatcctcgggcgccag
cgcaccctgccggaggtgatggtcctcgacctcatcgcccaggctgccgtcggcctgcag
gccatccacgaacgccagctgatccaccgcgacatcaaacccggcaacctcatggtcacc
gccgacggtgtcgtgaagatcaccgacttcggtatcgccaaggccgcttccgccgtcccg
ctgacccgtaccggcatggtggtcggcaccgcgcagtatgtgtccccggagcaggcacag
gggttgtccatccggccgtccagcgacgtctactcgctcggcgtggtcggctatgaagtg
ctcgtgggcgaacgtccgttctccggtgactccacggtgtcggtggcgttgaagcacatc
aacgaacctgcacccgagctccccgagaacatcagcgccccgatgcgccagttgatcgcg
atctgcctgcgcaaggatcctgcgcgccggtatccggacggtgcagcgctggcggccgcc
accgtcccggtgcgcgacggtgagatgcccccggacccggccagcggggtggcaccggtc
gttgccgctgccaccgccggacaggccccgaccggccagggccggctcggtgaagtcacc
gatgaagcgaacatgggtccggcgccccgcacccgcagtaaccgcggctggatctgggca
ctgggcatcggcctggtcgcactcctcggtgtcctggtgtggttcctcacccagggcgac
gacgaatccgcggtgccgccgacggagacgaccacggtcaccagtgaagtcaccgaggag
cagaccgtcgtccccgagccgatcgagaccgaagatcccgtggagacaccgacggacgat
acgacgcccaccgacacgacgcctaccgagggcccgacagacggcccgaccgacaccacg
aacccctcgcagccgacccaacccacggtcccggagcccgaggtgccgacggaggagccc
acgaatcccggtaaccccgacacctctgaccaggcatctcaggaacagccggaccccagt
ggtaacgccgggaccaccggcgacggtgactccggggacgaggagtccggctggagcgtc
atgggacgtctgtga

DBGET integrated database retrieval system