KEGG   Corynebacterium glyciniphilum: CGLY_04260Help
Entry
CGLY_04260        CDS       T03073                                 

Definition
(GenBank) Hypothetical protein
  KO
K07058  membrane protein
Organism
cgy  Corynebacterium glyciniphilum
Brite
KEGG Orthology (KO) [BR:cgy00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    CGLY_04260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: AHW63300
UniProt: X5E7B8
LinkDB All DBs
Position
923580..924671
Genome map
AA seq 363 aa AA seqDB search
MARTITASDRDKLDDHGIERSTDDSPGAIDRYRDKWPWFDHVMRMNERYTDQGGNNFAAG
ITYFSVLSIFPLIMLCFATVAMVVAGNQELIDKITETVTDSAGGELGDTLNDIIMQAIDQ
RGSVFGIGLVLALWTGLGWMGNLRIGVSNMWKTPGQADNFIKGKISDLIGLIGLLLALVV
AFAVTAFGGGGFTSSVLETIGLGDIPGIRILTWLVALVVALIANWIVFFWLMLYLPRTRV
PRPAAARAAVIGALAFEVIKQIATVVFSNALSNPAGAAFGPVIGVMVVLYLVWRVTLYLA
AWTATTPEALASMIPEAPPAAVIRVRQEVRPGARNISTAGLVGLGTAVGATAVGLLGKAF
RRK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcacgatcaccgcctccgaccgggacaagttggacgaccacggcatcgaacgg
tccacggacgactcaccgggggcgattgaccggtaccgtgacaaatggccctggttcgac
cacgtgatgcgcatgaacgagcgctacacggatcagggcggcaacaacttcgctgccggc
atcacctacttctccgtcctctcgatcttcccgctgatcatgctgtgcttcgccaccgtc
gccatggtggtcgccggaaaccaggaactgatcgataagatcacggagaccgtcaccgac
tccgccggcggtgaactcggggacaccctcaacgacatcatcatgcaggcgatcgaccag
cgcggcagcgtcttcggtatcggtcttgtgctggcgctgtggaccggcctggggtggatg
ggcaatctccgcatcggggtgtccaacatgtggaagaccccgggacaggccgacaacttc
atcaagggaaagatcagcgacctgatcggtctgatcggccttctgctggctcttgtcgtc
gcgttcgccgtgaccgccttcggtggcggtggtttcaccagcagtgtcctcgagaccatc
gggctgggcgacattcccggtatccggattctcacctggttggtcgccctggtcgtcgcc
ctcatcgcaaactggatcgtcttcttctggttgatgctctatctgccgcgcacccgcgtg
ccgcgtccggcggcggcacgggccgccgtgatcggtgcactggccttcgaggtaatcaag
cagatcgccaccgtcgtcttctccaacgcgttgtcgaatccggcgggtgcggccttcggt
cccgtcatcggtgtgatggtcgtgctctacctcgtgtggcgcgtcacgctctacctcgcg
gcatggaccgctacgacgccggaagcgcttgcatccatgattcccgaggcgccgcctgcc
gcagtgatccgcgtgcgccaggaggtgcgccccggtgcccgcaacatcagcaccgcaggg
ctggttggcctcggaaccgctgtcggtgcgactgcggttggtctgctcggtaaggctttc
cgccggaagtag

DBGET integrated database retrieval system