KEGG   Chlamydia gallinacea: M787_001120Help
Entry
M787_001120       CDS       T04276                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
cgz  Chlamydia gallinacea
Pathway
cgz00471  D-Glutamine and D-glutamate metabolism
cgz00550  Peptidoglycan biosynthesis
cgz01100  Metabolic pathways
cgz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cgz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    M787_001120
   00473 D-Alanine metabolism
    M787_001120
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M787_001120
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    M787_001120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cgz01011]
    M787_001120
Enzymes [BR:cgz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     M787_001120
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     M787_001120
Peptidoglycan biosynthesis and degradation proteins [BR:cgz01011]
 Precursor biosynthesis
  Amino acid ligase
   M787_001120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Mur_ligase Dala_Dala_lig_N Mur_ligase_M Mur_ligase_C CPSase_L_D2 ATP-grasp ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ANG65928
UniProt: A0A173DYB1
LinkDB All DBs
Position
complement(248675..251119)
Genome map
AA seq 814 aa AA seqDB search
MNTVHYHFIGIGGIGMSALAHILLDRGHCVSGSDVRTSVIIDTLRSKGATCFLGHDKNHV
PKKGYVVYSSGIADDNVEYQEAKSLRIPLIHRSVLLAQLMENHTSILISGSHGKTTVSSL
ITAILKTANQDPSYAIGGLNAESLNGYAGHTKYFIAEADESDGSLRNYSPSAVVITNVDN
EHLNNFENDRRKLVDSLEEFARKVPDPRYCFYSSDCSELRARIQGVSYGFSEKDDLYISS
FSQQGWQSVFSIKFLGKEYHDIRVWLVGKHNVANAAVAMGMALTLGIDEGHIRAGLKNFS
GIQRRLERKNHSEKFLFLEDYAHHPREIMCTLRGVRDAIGSRRILAICQPHRFSRLYACL
EDFYVAFRDADEVILTDVYSAGETPVTLPDIEKIASMISKLSHVQCYYIPYDHIVSYLKQ
NICVHDVCLALGAGNIDAIGNALQDFEPKKLSVGIICGGQSYEHDISLLSAKNVASYFSS
EHYDVSYFIINRQGLWKKVDHLHDVLYSGQGVFSSILSEEIASALNDTEFVFPILHGPFG
EDGTLQGFVEMLGKPYGGPSLLCASIGMDKVMTKLIASSVGVPVVPYQTLTLRAWKRSPE
LCLQNLLTTFTFPMFVKTVHLGSSLGIFEVHNEQELHEKISEAFLYDTDVFVEESRLGSR
EIEISCIGDASTCYYMTEPHERGSRQFIDYETKYGLNNRDRAQINYHPDLSLEEKTTVKE
LAKKVYRVLRGQGSCRIDFFLDHEGNFWLSEVNPIPGMTKDSPFLHGFLHLGWTPEQVIH
EIIISGLYKFRCRRSVSMNNEPNQRSTIKKLKTP
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagtccattaccattttatcggtattggtggaataggaatgagtgccttagcg
catattctgttagatcgagggcattgtgtttctggaagtgacgtacgcacgagtgtaatt
atagatactttaagatctaaaggagcaacatgcttcttggggcacgataagaatcatgtt
cctaaaaagggttatgtagtctatagctcagggattgcagatgataatgtagaatatcag
gaagcaaagtctttacggattcctttgattcatcgttctgtattattggcacaattaatg
gaaaatcatacgagtattctgatttccggtagtcacgggaaaacaaccgtatcttcatta
atcactgccattttgaaaacagcaaatcaagacccttcctatgctattgggggcctaaat
gctgagtctttgaatggatatgcaggacatacgaaatattttatagcagaagcggatgag
agtgatggttctttgcgaaattattctccatcagctgttgtgattaccaatgtggataat
gagcatttaaataatttcgaaaatgatcggaggaaattagtcgattctttggaagaattt
gctagaaaagtccctgaccctcgctattgtttttattccagtgattgctccgagctacgt
gcacggattcaaggagtttcctatggattttctgagaaagatgacctttacatttcttca
tttagtcagcagggatggcaatccgtattttcaataaaatttttaggtaaagaatatcac
gatatccgtgtctggcttgtaggtaagcataatgtagcgaatgctgcagttgctatgggg
atggcattaacattgggtatagatgaaggtcatatccgtgcaggattgaagaatttttca
ggtattcagaggcgtttggagagaaaaaatcactcagaaaagtttttgtttcttgaagat
tatgctcatcatccccgagagattatgtgtacgttacggggagtgcgagatgctatcgga
tctcggcggattcttgctatatgtcagccacataggttttcacgattatatgcatgttta
gaggatttttatgttgcgtttcgcgatgctgatgaagtgatacttactgatgtctatagt
gctggagaaactcccgtaactttgcctgatattgaaaagatagcttctatgatctctaag
ttgtcacatgtacaatgttattatatcccttatgatcatattgtgagttacctgaaacaa
aatatttgtgttcatgatgtttgcctagcactaggtgcaggaaacattgatgctataggg
aatgctttacaagattttgaacctaaaaagctgtctgtaggtattatctgtggagggcaa
tcgtatgaacatgatatttctctactttctgctaagaacgtagcttcatatttttcttct
gagcattatgacgtgagctattttattatcaatcgtcaagggctttggaaaaaagtcgat
catctacatgatgttctatacagtggtcaaggtgttttttcttctattctctcagaagag
attgccagtgcgctgaatgatacggagtttgtttttcctattttacacggcccttttgga
gaagatggaactcttcaaggtttcgtagaaatgcttgggaaaccctatggaggaccttct
cttctctgtgcctctataggtatggataaagttatgactaagcttattgcctcttcagtc
ggtgttccagtagtcccttatcaaacattaaccttacgagcttggaaacgctctcccgaa
ttatgtcttcagaatctcttgactacgtttacttttcccatgtttgtcaagacagtgcat
ttaggatcaagtttgggaatctttgaggttcataatgaacaagaacttcatgagaaaatt
tctgaagcttttttatatgataccgatgtgtttgtcgaagaaagtcggttgggatctcga
gaaattgaaatctcttgtataggggacgcgagtacttgctattatatgacagagcctcat
gaacgtggatcacgacaatttatcgattatgaaaccaaatatggtttaaataatagggac
agggcgcaaataaattaccatccggatttatctttggaagaaaaaaccacagtcaaagaa
ttggcaaaaaaagtataccgcgtgctacgaggtcaaggttcttgtagaatagatttcttt
ttggatcatgaaggaaatttttggctttccgaagttaatcctattccaggaatgaccaaa
gatagtccttttttacacggctttttacatttaggatggactccggaacaagtaattcat
gaaataattatctcaggattatataaatttagatgtagacgttctgtttctatgaataat
gaacctaatcaacgtagcacaataaaaaagctaaaaaccccttaa

DBGET integrated database retrieval system