KEGG   Campylobacter hominis: CHAB381_1228Help
Entry
CHAB381_1228      CDS       T00577                                 

Definition
(GenBank) restriction endonuclease R.IB
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
cha  Campylobacter hominis
Brite
Enzymes [BR:cha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     CHAB381_1228
Prokaryotic defense system [BR:cha02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    CHAB381_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII
Motif
Other DBs
NCBI-ProteinID: ABS51972
UniProt: A7I2P1
LinkDB All DBs
Position
1169774..1170595
Genome map
AA seq 273 aa AA seqDB search
MKNKISFNDFLKTLQKTNATLDYFVNFKKCSTNIKKISIHLNQLNYLLNKQDLKSEIEFL
FSKNKECFSVLNLLIAVRDKNTKLLDECGNLIDLKNYFENPKQIYDFFKQTGLEEIFKNS
EIKNLNDYVFGIEVGLDTNARKNRGGTNFENLIAKKLDKEKIQYKKEVKSTNFADLDLGK
DLKRFDFVIKSKNFTYLIETNFYNSGGSKLNEVARGYTEINAKISLNNKYKFIWITDGQG
WLSAKNKLEEAYKSVEIYNLSNLKEFIDKVKNG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaaatttcatttaatgattttttaaaaactctacaaaaaacaaatgctaca
cttgattattttgtaaattttaaaaaatgctctacaaacataaaaaagatctctattcat
ttaaaccaattaaattatttgttaaataagcaggatttaaaatcagaaattgagttttta
tttagcaaaaacaaagagtgtttttctgtgctaaatttgttgattgctgtgcgagataaa
aatacaaaactacttgatgaatgtggaaatttaatagatttaaaaaactattttgaaaat
ccaaaacaaatttatgattttttcaaacaaacagggcttgaagaaattttcaaaaactca
gaaattaaaaatttaaatgattatgtttttggtatagaggtaggcttggatacaaatgct
aggaaaaatcgaggcggaacaaattttgagaatttaattgccaaaaaactagataaagaa
aaaattcagtataaaaaagaggtaaaaagcactaattttgctgatttggatttgggaaag
gatctaaaaagatttgattttgttataaaatctaaaaattttacatatttaattgagaca
aatttctataactcaggcggttcaaaattaaacgaagttgcaagaggctacaccgaaata
aatgcaaaaatttctttaaacaataaatataaatttatttggataacagatggacaaggc
tggttaagcgctaaaaataaacttgaagaagcctataaaagtgttgaaatttacaactta
tccaacttaaaagaatttattgacaaggtaaaaaatggctaa

DBGET integrated database retrieval system