KEGG   Chlamydia psittaci C19/98: CPS0C_0045Help
Entry
CPS0C_0045        CDS       T01863                                 

Definition
(GenBank) putative serine/threonine protein kinase
Organism
chc  Chlamydia psittaci C19/98
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Kdo Kinase-like Haspin_kinase Seadorna_VP7 SpoIIE Choline_kinase
Motif
Other DBs
NCBI-ProteinID: AEG85096
LinkDB All DBs
Position
47983..49491
Genome map
AA seq 502 aa AA seqDB search
MDCQSEILPLNQAIGAYHIKKILSKKEGSAVYQGLHSETLQSAAIKVLEPPLVADTRRVH
NFLKEARIIEQVSHPHIVKLYQYGQCREGLYIAMEYIQGVSLRQYILTHLIPLSKAIDIV
LHIGQAIEYLHSRGILHRDIKPENILINSQGQIKLIDFGLAVCSSTEHASHPACLGTPSY
MSPEQRQGDKVSEKSEIYSLGLIAYELISGNLALGKVILSLIPDRVSKILAKALQPSPKD
RYGSMKEFMSHLHRYRYSQDLQKDYRNKDYTAQVNEQLYQQRFWLSPTEIVVPDFLSVSI
YEQGYPTHPHVYYEAYMSQDTFRLWFCYSLSGNATLVLTIIKTFVSQWGHEDNIRSTMRK
MHSELMRINVPIDTTEISLVCVTIPKEKKELSWITCGKTSFWLKKQGKVPQNFTTSSLGL
GKISSLQIQETKVAWEIGDGAVLHTLQADDSMSSLNSPLFTELKDRGQTAIFCPIESVQF
GILENHDGNLCPSTLISLKRIR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggattgtcaatccgaaatacttcctctgaatcaggcaataggtgcttaccacatcaag
aaaatcctgagtaagaaagaaggaagcgcggtgtaccagggtttgcattctgaaactcta
caatctgcagctattaaagtgcttgaaccgcctttagttgctgatacgcgcagagttcat
aactttttaaaagaagcacgaattattgaacaagtctcacatccccatattgttaagtta
tatcaatatggacagtgtagagaaggtctgtatatagccatggaatatatacaaggcgtg
tctcttagacagtatatcctcacccatctaattcctttatccaaggctattgatatagtg
ttacatattggccaggctatagaatatctgcatagccgtggtatactccatagggatatc
aaacccgaaaatatcctgattaattctcaagggcaaatcaaactcatagattttggactt
gctgtttgttcttctacagaacatgcttctcatcctgcttgtttaggaacgccttcatat
atgagccctgaacaacgtcaaggagataaagtttctgaaaaatcagaaatctactctcta
ggtttaattgcttatgaattgatctcgggaaacctagctctaggtaaggtcattttatca
ttgattccggatagagtgagtaagattttagcgaaggccttgcaaccttctcctaaagat
cgttacggatctatgaaagaattcatgagtcatttacatcgatatcggtacagccaagac
cttcagaaagattatcgtaataaagattatacagcacaggttaatgagcagctgtatcag
cagagattttggttatctcctacagaaattgttgtccccgacttcttatccgtttctata
tatgagcaaggatacccaacacatcctcatgtatactacgaagcttatatgagtcaggat
actttccggttgtggttttgttatagtctttcaggaaatgcaactttagtattaactatt
ataaaaaccttcgtaagtcagtggggccatgaagataacattagaagtacgatgcgaaaa
atgcatagtgagctaatgcggatcaatgttcctattgatacaacggaaatttctttagtt
tgcgttactattcccaaagaaaaaaaggaactttcttggattacttgtgggaaaactagt
ttctggttaaaaaaacaaggaaaggttcctcagaattttactacttcatccttaggttta
gggaaaattagttctttacaaattcaggaaaccaaggttgcatgggaaataggtgatgga
gcagtattacataccttacaggcagacgattccatgtcatctttaaatagtcctttattc
acagagttgaaagatagaggacaaacagctatattctgcccaatagagagcgtacagttc
gggatattagaaaatcatgacggaaatctttgtccctcaacacttatcagcttaaaaaga
atccggtga

DBGET integrated database retrieval system