KEGG   Chlamydia psittaci C19/98: CPS0C_0927Help
Entry
CPS0C_0927        CDS       T01863                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
chc  Chlamydia psittaci C19/98
Pathway
chc00471  D-Glutamine and D-glutamate metabolism
chc00550  Peptidoglycan biosynthesis
chc01100  Metabolic pathways
chc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:chc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CPS0C_0927 (murC)
   00473 D-Alanine metabolism
    CPS0C_0927 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CPS0C_0927 (murC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CPS0C_0927 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:chc01011]
    CPS0C_0927 (murC)
Enzymes [BR:chc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CPS0C_0927 (murC)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     CPS0C_0927 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:chc01011]
 Precursor biosynthesis
  Amino acid ligase
   CPS0C_0927 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N Mur_ligase Mur_ligase_M Mur_ligase_C CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEG85886
LinkDB All DBs
Position
complement(981978..984410)
Genome map
AA seq 810 aa AA seqDB search
MDRKIHYHFIGIGGIGMSALAHILLDRGYSVSGSDLNRGAIIDKLVAKGARYLQGHDKHH
IPEDCTIIYGSGIAKDNVEYLEAVRKQLPILHRSELLAFLMQEQTSILVSGSHGKTTVSS
LITAIFQTAKKDPSYAIGGLNSLSLNGYSGSSEYFIAEADESDGSLKHYLPKVAVVTNLD
NEHLSNFEGSKEKLALTIEEFTRKVEDPRLCFYNGDCQELKGRISGTSYGFSQDCNLRIH
SYYQDGWRSLFSLSFLGKDYLDIDLNLIGKHNIANAAVAMGIALTLGIDEESIREALKNF
SGIQRRMERKNVSEKFLFFEDYAHHPSEISCTLRGLRDAVGLRRIVAICQPHRFSRLQYC
LEDFYKAFQDADEVILTDVYSAGETALDLPSPEKLAETISLSSHVQCSYVPYDNIIPYLQ
QEIRVHDVCISLGAGNIYTVGNALKDFEPRKLAVGVVCGGKSCEHDISLLSARNVVRYLS
PEYYDVQYFIIDRQGLWSKVSTIECEDYEGKGHYVLSSEITEALTHVDFILPILHGPFGE
DGTLQGFLEIINKPYAGPSLLFSSVTMDKIMTKRLAASVGVPVVPYQPLTLHAWKRTPEL
CMHKISEAFTFPMFVKTAHLGSSIGVFEVHNEEELKAKISEAFLYDTDIFIEESRLGSRE
IEVSCLGDSSSCYYISEPHERCGEKRFISYEEKYGLNGRASAQIQYDLDLSEESKIRVKE
FTERVYRVIQGQGSCRVDFFLDDEGNFWLSEMNPIPGMTQASPFLHDFARLGWTFEQIIH
QLIISGLHKFDRKKKVGKTLNKQCLLTAKS
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atggataggaaaatccactatcattttataggtatcggcggaataggaatgagtgcacta
gctcatattttattagaccggggatattccgtatcaggaagtgatttaaatcgaggagcc
attatcgataagcttgtggccaaaggggcacggtatttacaagggcatgataaacatcat
attcctgaagattgcactatcatctatggatcagggatcgctaaggataacgtagaatat
ctagaagctgtaaggaaacagttacccatactccatcgttctgaacttctcgcttttttg
atgcaagaacaaacaagtattttagtttcagggagtcatggcaaaacgacagtatcttcg
ttaatcaccgccattttccaaacagcaaaaaaagatccttcctatgctattggaggtctg
aattctctatctttgaatggttattcaggaagctcagagtactttatagcggaagctgat
gaaagcgacggctctttaaaacactatcttcctaaagttgctgttgtaaccaatttagat
aatgaacatctcagtaattttgaagggagtaaggagaaacttgctttaacaattgaagaa
ttcactcgtaaggttgaagatccgcgtttatgtttttataatggcgattgccaagaactt
aaaggaagaatctcaggaacatcttatggattttctcaagattgtaacttacgtatacat
tcctattatcaagatggctggcgctcgctattttctctgtctttcttagggaaagattac
ttggacatagatcttaaccttatcggtaagcacaacattgcaaacgctgctgtagctatg
ggtatagcattaactttgggtattgatgaggaaagtattcgagaggctcttaagaacttt
tctggtattcaaagacgtatggaaagaaagaatgtttcagagaaattcttattctttgaa
gactatgcacaccatccttctgagatctcttgcactctaagaggattacgagatgctgtt
ggcttgcgtcgtatagttgcgatatgtcaaccacatagattttctagattgcaatattgt
ctggaagatttttataaagcttttcaagatgctgatgaggtgattctcactgatgtctac
agtgctggagaaactgcattagatttaccgtctcctgagaaattagcagagacgatttcc
ttatcctctcatgtacaatgtagctatgttccttatgacaacattatcccatacctgcaa
caagaaatacgcgttcatgatgtgtgtatatctttaggagctggaaatatttataccgta
ggcaatgctttaaaggattttgaacctaggaagctcgcagttggagttgtctgtggaggg
aagtcttgcgaacacgatatttctttgttgtctgcgagaaatgtcgttcggtatttgtct
cctgaatactacgatgtgcaatactttattatcgatcgccagggattatggtcaaaagtc
tccactattgaatgtgaagattatgaagggaaaggtcattacgtcttgtcttcagagata
acagaggctcttacacatgtagattttatccttccgatattacatggcccttttggagag
gacggtacgcttcagggatttttagaaattatcaataagccctatgctggaccctctctg
ctcttttcctcagtcactatggataagattatgacaaaacgccttgcagcttctgtaggt
gttcccgtggttccttatcagccattgactttacatgcttggaaaagaactccagagtta
tgtatgcataagatttcagaggcctttacttttcctatgtttgtgaaaactgcacatttg
ggatcgagtattggggtttttgaagtgcataatgaagaagaactaaaagcaaaaatatct
gaagctttcctatatgatacagatatttttatcgaagaaagtcgtttaggatctcgcgaa
attgaagtgtcttgtctcggagactccagtagctgttactatatttctgaaccacatgaa
cgttgtggtgagaaaagatttattagttatgaagagaaatatggattaaacggtagagca
agcgctcaaatacaatacgatttggatctctccgaagaatctaaaataagagtaaaggag
ttcacagaacgtgtgtaccgtgtgattcaaggacaaggttcatgtagagtcgatttcttt
ttagatgatgaaggaaatttttggctttctgaaatgaaccctattccaggaatgacacag
gcaagtccttttcttcatgattttgcccgtttaggatggacttttgaacaaatcattcat
caattgattatatcagggctacataagtttgatcggaagaaaaaggtcggaaagactttg
aataagcagtgtctattaactgcgaagagctaa

DBGET integrated database retrieval system