KEGG   Caldicellulosiruptor hydrothermalis: Calhy_1814Help
Entry
Calhy_1814        CDS       T01346                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
chd00010  Glycolysis / Gluconeogenesis
chd00020  Citrate cycle (TCA cycle)
chd00620  Pyruvate metabolism
chd00633  Nitrotoluene degradation
chd00640  Propanoate metabolism
chd00650  Butanoate metabolism
chd00680  Methane metabolism
chd01100  Metabolic pathways
chd01110  Biosynthesis of secondary metabolites
chd01120  Microbial metabolism in diverse environments
chd01130  Biosynthesis of antibiotics
chd01200  Carbon metabolism
Module
chd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:chd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calhy_1814
   00020 Citrate cycle (TCA cycle)
    Calhy_1814
   00620 Pyruvate metabolism
    Calhy_1814
   00640 Propanoate metabolism
    Calhy_1814
   00650 Butanoate metabolism
    Calhy_1814
  09102 Energy metabolism
   00680 Methane metabolism
    Calhy_1814
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calhy_1814
Enzymes [BR:chd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calhy_1814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ADQ07525
UniProt: E4QD31
LinkDB All DBs
Position
complement(1837937..1839118)
Genome map
AA seq 393 aa AA seqDB search
MAIRDRLSGNEAVAFAMKQINPDVVAAFPITPSTEVPQYFSQYVANGEVDTEFVAVESEH
SAMSACIGASAAGARTMTATSSQGLALMWEMLYIAASMRLPIVMAVINRALSGPINIHND
HSDSMGARDSGWIQIYCENNQEAYDSLIQAIRIAEHKDVRLPVMVCYDGFITSHAVENIE
LLEDELVKKFVGEYNPEFYLLNEQNPISMGPLDLPPYYFEHKRQQAEAMKNAKKVVLEVA
EEFAALTGRKYGLFEAYKLDDAEVAIVVMNSTAGTAKAVVDEYRSKGYKVGLLKPRLFRP
FPVDEIVGALKHLKAVAIMDKSDGFNAAGGPLFTEITSALYGRAEGIKAINYIYGLGGRD
VKTDDIAKVYDRLLDIVKTGNVGEVYNYIGVRE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggctattcgtgatagactttctggtaacgaagcggtagcttttgcaatgaaacagata
aaccctgatgttgttgccgcttttccaattacaccttcaactgaggtaccacaatatttt
tctcaatatgttgcaaacggtgaggtagacactgagtttgttgctgttgagtctgagcac
agcgcaatgagcgcatgtattggtgcgtcagctgctggagcccgaacaatgacagcaaca
tcctcacaaggtcttgcactcatgtgggagatgctctacattgcagcgtcaatgagactt
ccaattgttatggcagttataaacagagctctttctggtcctattaatattcacaacgac
cattcagactcaatgggtgcaagagatagtggctggattcagatttactgcgaaaacaac
caggaagcttacgactctttgattcaggcaataaggattgctgaacacaaggatgtaaga
cttcctgtgatggtttgctatgacggatttattacaagccatgctgttgaaaatatagag
cttttggaagatgaacttgtaaagaagtttgtaggtgaatacaatccagagttttatctt
ttgaacgagcaaaacccaatttcaatgggtccgttagacttgccaccatactactttgag
cacaaaaggcagcaggctgaagctatgaaaaacgctaaaaaggtagtacttgaggttgca
gaagagtttgctgccttgacaggcagaaagtatggtctttttgaggcatacaagcttgac
gatgcagaggttgcaattgttgttatgaactcaacagcaggaacagctaaagctgttgtt
gacgagtacagaagcaaagggtacaaggtaggtcttttaaagccaagacttttcagacca
ttccctgttgatgagattgtaggggcactcaagcacttaaaagcagttgctataatggac
aaatcagatggatttaacgcagctggcggtccacttttcactgagattacaagtgctctt
tatggaagagcagagggcataaaggctatcaactacatctatggtcttggcggaagagat
gtcaagacagatgacatcgcaaaggtttatgacagacttcttgacattgtcaagacagga
aatgttggagaagtttacaactacattggtgtgagagaataa

DBGET integrated database retrieval system