KEGG   Caldicellulosiruptor hydrothermalis: Calhy_1877Help
Entry
Calhy_1877        CDS       T01346                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
chd  Caldicellulosiruptor hydrothermalis
Brite
KEGG Orthology (KO) [BR:chd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:chd03012]
    Calhy_1877
   03029 Mitochondrial biogenesis [BR:chd03029]
    Calhy_1877
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chd04147]
    Calhy_1877
Translation factors [BR:chd03012]
 Eukaryotic Type
  Elongation factors
   Calhy_1877
 Prokaryotic Type
   Calhy_1877
Mitochondrial biogenesis [BR:chd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Calhy_1877
Exosome [BR:chd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Calhy_1877
  Exosomal proteins of breast cancer cells
   Calhy_1877
  Exosomal proteins of colorectal cancer cells
   Calhy_1877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: ADQ07587
UniProt: E4QDG9
LinkDB All DBs
Position
complement(1904876..1906078)
Genome map
AA seq 400 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLALKGKAQFMAYDQIDKAPEERERG
ITINTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVNVPYIVVFLNKVDMVDDPELIELVEMEVRELLSKYGYPGDEVPIVKGSALKALE
STSQDPNAPEYQCILELMDAVDKYIPTPQRDIDKPFLMPIEDVFSITGRGTVVTGRVERG
TLKTGEEVEIVGFAPEPRKTVVTGIEMFRKVLDEAVAGDNVGCLLRGIQKNEVERGQVLA
KPGTIKPHTKFKAQVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGTITLPEGVEMCMPG
DNVEMTVELISPIAIESGLRFAIREGGRTVGAGSVTTIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctaaatttgaaagaacaaaaccacacgtaaacataggtacaattggacac
gttgaccatggaaaaacaacattgacagctgcaatcacaaaggttttagctctcaaaggt
aaagcacagtttatggcttatgaccagattgacaaggctccagaggaaagagaaagaggt
attacaatcaacacagcacacgttgagtatgagacagacgcaagacactatgcacacgtt
gactgtccaggtcacgctgactacgtcaagaacatgataacaggtgctgctcagatggac
ggtgcaatcttggttgtgtctgcagcagacggtccaatgccacagacaagagagcacatt
ttgcttgcacgacaggttaacgttccatacatcgttgtattcctcaacaaggttgacatg
gtagacgatccagaattgattgagctggttgaaatggaagtaagagagcttctttccaag
tatggctatccaggcgacgaagtaccaatagtaaaaggttcagctttgaaggctttagag
tcaacatcacaagacccaaatgctccagaatatcagtgcatcttagagctcatggatgct
gttgacaaatacatcccaacaccacagagagacattgacaaaccattcttgatgccaatt
gaagacgtgttctcaatcacaggtagaggtactgttgtaacaggtagagttgaaagagga
acactcaagacaggcgaagaggttgaaatagttggttttgctccagagccaagaaagaca
gttgtaacaggtatcgagatgttcagaaaggtacttgacgaggctgttgctggtgacaat
gtagggtgccttctcagaggtattcagaagaatgaggttgaaagaggtcaggttcttgca
aagccaggcacaattaaacctcacaccaaattcaaagcacaggtttacgttttgacaaaa
gaagagggtggaagacatacaccattcttcaatggttacagaccacagttctatttcaga
acaacagacgttacaggaacaatcacactgccagagggtgtagagatgtgcatgcctggc
gacaacgttgagatgacagttgagcttatctctccaatcgctattgagtcaggactcaga
tttgctatccgcgaaggcggaagaacagttggtgcaggttctgttacaacaataattgaa
taa

DBGET integrated database retrieval system