KEGG   Cardinium endosymbiont cEper1 (Encarsia pergandiella): CAHE_0408Help
Entry
CAHE_0408         CDS       T02243                                 

Definition
(GenBank) Putative uncharacterized protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
che  Cardinium endosymbiont cEper1 (Encarsia pergandiella)
Pathway
che00473  D-Alanine metabolism
che00550  Peptidoglycan biosynthesis
che01100  Metabolic pathways
che01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:che00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CAHE_0408
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CAHE_0408
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CAHE_0408
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:che01011]
    CAHE_0408
Enzymes [BR:che01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CAHE_0408
Peptidoglycan biosynthesis and degradation proteins [BR:che01011]
 Precursor biosynthesis
  Amino acid ligase
   CAHE_0408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_N Dala_Dala_lig_C ATP-grasp_4 IPU_b_solenoid ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CCM10185
UniProt: K0P9S6
LinkDB All DBs
Position
complement(427175..428494)
Genome map
AA seq 439 aa AA seqDB search
MHKKIGVLMGGFTPERHVSLESGRNIYSKLAASNQYEALPLFLSGSTKAFRIFILPAALL
LKDNADDVHDALLHPTRFRAAEALLTVIRQEAVSITKNYAKDAIFTAEELTFSALKERID
FIFIALHGRPGEDGTLQKILEKYDIPYNGSGIATTALTIDKYATNQFLAKKGFQVAQQLV
VTQKDWDDDQVTTIHAVANLFTYPIIAKPVDDGCSAGVMRIVNSDMLTAYASATFRDKPL
MSNKVMQPLGLQVADYIPQQKRFLLEALIEKDPKALACLETTTGLLTHIDHNGKTLYEVF
EPSETVAVDAILSLEEKFLAGEGHNITPARFDGNAKVAAIISKKVKHELANIATVLNIQG
YARIDAFVKIYPHQKIEVWIIEINALPAMTPATCIFHQCALNGYTPFDFIHAIIQYGWTK
RNFAAYSETLILDTCIKKS
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaaaaataggtgtactaatgggtgggtttacacccgaacggcatgtatcatta
gaaagtgggcgaaatatttacagtaaattggccgcttctaaccaatacgaagcgcttccg
ctttttctatctggctctacgaaggcctttcgaatttttatactacctgctgcgctattg
ttaaaagataatgcagatgatgtgcacgatgcgcttttacatccaactagatttagagcc
gcagaagcgttattaaccgttataagacaagaagccgtttccattactaaaaattatgca
aaagatgctatttttacggcagaagaacttaccttttctgctttaaaagaaagaatagat
tttatctttatcgctttgcatggcaggcctggagaagatggaactctacaaaagatacta
gaaaagtatgatataccttacaacggatctggtatagctactaccgctttaacgatcgat
aaatatgcaaccaatcaatttttagctaaaaaaggatttcaggttgcacagcagcttgtg
gttacccaaaaagattgggatgatgatcaggttactacgatccatgctgtagcgaatctg
tttacgtatccaattattgctaaacctgtagatgatggttgcagtgcgggggtcatgcgc
attgtcaatagtgatatgttgactgcttatgcatctgctacttttagagataaaccacta
atgtctaacaaagtgatgcaacccttggggttacaagtagcagactatattccgcaacaa
aaacgatttctactagaagcactgattgaaaaagatccaaaagcattggcttgtttagaa
actacaacaggtttactaacccatatagatcataatgggaaaaccttatatgaagtattt
gaaccttcagaaacggtagcagtagatgccatactttcattagaagaaaaatttttagca
ggggaaggccataatattaccccagcacgctttgatggtaatgccaaagtagctgctata
atcagcaaaaaggtcaagcacgaactggcaaatatagcaacggttttaaatatacaaggt
tatgccagaatagatgcttttgtaaaaatctatccccatcaaaaaatagaggtatggatt
attgaaatcaatgcactgcctgctatgacaccagctacctgtatttttcaccaatgtgct
ttaaacggttatacaccatttgattttatacatgccattatccaatatggatggaccaaa
agaaattttgctgcctatagcgaaacgctaatcttagatacatgcataaaaaaaagctaa

DBGET integrated database retrieval system